CAZyme Information: EPrPAT00000024587-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000024587-p1
• CAZy Family: GT71
• CAZyme Description: Glucan 1,3-beta-glucosidase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
723	PaphDAOMBR444_SC1087|CGC1	80552.09	7.9317

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

Full Sequence      

MLKRLVALTVALALAMSDALNVKLSGRCKSSGKVASEIRRLQTITNRVRIYSLTDCDVTR
VLTPARDLNMTVWLGLRVSEKRTVFSSEVAQLKSLIMKQLVTSELIDGINIGSEALYRNE
TTADDLVTKIGTVRTLLKENNIDIPLSITDTLGNLAENPEIVNTVDVVTFNQFPFWNKVP
IESAVADMEGSIDSFFNSTKSKPFVITETGWAAAGEDKMASKASPESAARYMKELYLLTE
KRGWKYYYFAGFDTPYRQKVEGNANSVEAFVATADSKMLSAKTLRHLQALPRGAIAPSLR
VSCVESSVNELHAKQPQLSSFSTSVGRARGAEVRVNGIALRDLARLPRAKLLDKFGSAKL
NAALKALPKQLDRMTHDATSHSPGFLRNIFSAAEKCNATRTMLAALDALHQHHDHDQSRR
RQFFFDGSMYNALYNTLQHENDRKTMLQVFRDFKTRVGDEATLPEVIYRFGIMGSFGEND
LDGVEELVREMRTSGVPITNEVWSQLMLGYAKANQVDRALQIFHFILNNSDVTKLHESDM
NRVILALGCARKPDLAFEFYRECQTPLSATVFNALLSVCIHNNAEREAVAIMQNRSRFGL
SLDAVGYSRVLEALEKFNKREDIIHTLLEMRRLDIHFGQKVQSVIKRNRDVLKGTPFAGN
EEEDVPAEELVVELHAALADDDTSRAIKAADSLVAPMLSPTNAISHADKTLLRLADECTK
PAQ

Enzyme Prediction     

No EC number prediction in EPrPAT00000024587-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	28	262	5.4e-19	0.8906752411575563

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.01e-33	25	270	56	297	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
276811	PPR	9.80e-07	428	524	2	95	Pentatricopeptide repeat, an RNA-binding module. The Pentatricopeptide repeat (PPR) is a 35-residue repeat motif that forms two anti-parallel alpha helices and binds single-stranded RNA in a sequence-specific and modular manner. It is present in a large family of RNA-binding proteins that are found in protists, fungi, and metazoan, but are most abundant in the mitochondria and chloroplasts of terrestrial plants. PPR proteins function in many aspects of RNA metabolism, including splicing, editing, degradation, and translation. They contain between 2 to 30 PPR repeats, organized into a hairpin of alpha helices. Proteins containing only arrays of PPR repeats that are 35-amino acid in length are called P class proteins. The second type of PPR proteins, called PLS class, contain additional C-terminal endonuclease or RNA editing domains and a distinct PPR architecture of triplet repeats alternating between a typical PPR, a longer PPR and a short PPR of 31 residues.
276811	PPR	5.61e-06	541	632	5	99	Pentatricopeptide repeat, an RNA-binding module. The Pentatricopeptide repeat (PPR) is a 35-residue repeat motif that forms two anti-parallel alpha helices and binds single-stranded RNA in a sequence-specific and modular manner. It is present in a large family of RNA-binding proteins that are found in protists, fungi, and metazoan, but are most abundant in the mitochondria and chloroplasts of terrestrial plants. PPR proteins function in many aspects of RNA metabolism, including splicing, editing, degradation, and translation. They contain between 2 to 30 PPR repeats, organized into a hairpin of alpha helices. Proteins containing only arrays of PPR repeats that are 35-amino acid in length are called P class proteins. The second type of PPR proteins, called PLS class, contain additional C-terminal endonuclease or RNA editing domains and a distinct PPR architecture of triplet repeats alternating between a typical PPR, a longer PPR and a short PPR of 31 residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56146.1|GH17	AIG56146.1|GH17	1.54e-45	14	276	12	287
AIG55438.1|GH17	AIG55438.1|GH17	4.00e-44	4	276	3	298
UIZ28880.1|GH17	UIZ28880.1|GH17	3.87e-42	27	270	35	283
AIG56392.1|GH17	AIG56392.1|GH17	2.53e-41	24	268	40	285
AIG55390.1|GH17	AIG55390.1|GH17	9.37e-41	24	268	43	288

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	4WTP_A	3.57e-27	28	263	49	278	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	4WTR_A	2.21e-26	28	263	49	278	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CAI0|BTGC_ASPCL	sp|A1CAI0|BTGC_ASPCL	1.24e-16	30	266	412	664	Probable glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=btgC PE=3 SV=1
sp|P15703|BGL2_YEAST	sp|P15703|BGL2_YEAST	1.19e-15	26	265	38	290	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|O13990|BGL2_SCHPO	sp|O13990|BGL2_SCHPO	5.80e-15	16	286	42	314	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4
sp|D4B2W4|BGL2_ARTBC	sp|D4B2W4|BGL2_ARTBC	7.46e-13	26	277	35	294	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
sp|Q5AMT2|BGL2_CANAL	sp|Q5AMT2|BGL2_CANAL	3.50e-10	26	265	33	285	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000210	0.999785	CS pos: 19-20. Pr: 0.9695

TMHMM  Annotations     

There is no transmembrane helices in EPrPAT00000024587-p1.