CAZyme Information: EPrPAT00000024219-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000024219-p1
• CAZy Family: GT61
• CAZyme Description: Glycoside hydrolase, family 31.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
628		70650.31	6.0728

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0949:4875-6967(-)

Full Sequence      

MKCFASFVAVLLATNIEHFYYGFAVTHPAFTAESTNQTISSLARYSNGSVILKGSVSIGV
ANASYAVGYSIELGQSRSKQLAFRVDVDADASKTVGVNRLLLEYLADEDEEFYGFGQQFP
VNLSLKGNRVPILVNEQGAGRGLEPLTTMLNTYSNHAGGDTLQTYAPMPHYQSTKLRQFF
LENSEYAVFDLTKNTTTRIELTSTTLKAQLSYGDSPLELIESFTAFNDRQRKLPSWISNG
AIVGTQGGREFVEDVYAKLKAAGTPIAAFWLQDWVGNRVASWGTALWWNWEVDEVRYPNW
TEFVSSLRKDNVRMMTYLNPHAGDVKGVKTDPAPKRYLYEELVDNGFAVKNSSGEIHLSY
QNAAMVDLTNSKAREWVKNLIKANILSNSVSGYMCDFGEALQLDAKVYNGDAATFHNRYP
EEWAKVNHEAVKELGREDDVVFFMRSGFTRSPQYTPLYWLGDQLQSWDQYDGLKNAVFAA
TVGGFSGISLTHPDIGGYNFLNVSGLPVYQRTKELYLRWAEFAAFTAAYRTHDGNSRAQW
QFYSDDETISYFTRNAQIYVAWGFYREQILNEVANKGHPLIRHLYLHYPDDATVRTVKYQ
FLVGTQLLVAPVVDEGQATVTLYLPKGK

Enzyme Prediction     

No EC number prediction in EPrPAT00000024219-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	212	628	6.8e-78	0.9063231850117096

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
236691	PRK10426	0.0	95	628	67	589	alpha-glucosidase; Provisional
269880	GH31_glucosidase_YihQ	1.94e-157	229	556	2	325	alpha-glucosidase YihQ-like. YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride. Orthologs of YihQ that have not yet been functionally characterized are present in plants and fungi. YihQ has sequence similarity to other GH31 enzymes such as CtsZ, a 6-alpha-glucosyltransferase from Bacillus globisporus, and YicI, an alpha-xylosidase from Echerichia coli. These latter two belong to different GH31 subfamilies than YihQ. In bacteria, YihQ (along with YihO) is important for bacterial O-antigen capsule assembly and translocation.
224418	YicI	1.43e-83	108	627	151	634	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
395838	Glyco_hydro_31	1.35e-63	212	628	4	407	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
269878	GH31_NET37	2.25e-42	289	628	49	363	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIN82013.1|GH31	3.06e-176	36	628	107	688
ABG05503.1|GH31	5.25e-171	67	628	136	684
QYG01201.1|GH31	6.54e-157	32	627	107	697
KAF7036291.1|GH31	1.30e-155	98	625	303	834
BAJ97257.1|GH31	7.21e-155	98	625	307	834

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AED_A	4.86e-107	76	626	84	632	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AED_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEG_A A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5AEG_B A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5OHT_A A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12],5OHT_B A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12]
5AEE_A	2.65e-106	76	626	84	632	A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEE_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12]
6PNR_A	9.94e-103	97	628	99	620	Chain A, Alpha-glucosidase [[Eubacterium] rectale],6PNR_C Chain C, Alpha-glucosidase [[Eubacterium] rectale]
5OHY_A	3.47e-97	68	625	64	614	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHY_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]
5OHS_A	1.88e-96	68	625	64	614	Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_E Chain E, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_F Chain F, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_G Chain G, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],5OHS_H Chain H, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_A Chain A, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_B Chain B, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_C Chain C, Alpha-glucosidase yihQ [Agrobacterium tumefaciens],7OFX_D Chain D, Alpha-glucosidase yihQ [Agrobacterium tumefaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32138|SQASE_ECOLI	2.04e-106	76	626	84	632	Sulfoquinovosidase OS=Escherichia coli (strain K12) OX=83333 GN=yihQ PE=1 SV=3
sp|P96793|XYLQ_LACPE	1.82e-28	109	628	157	636	Alpha-xylosidase XylQ OS=Lactiplantibacillus pentosus OX=1589 GN=xylQ PE=1 SV=1
sp|P31434|XYLS_ECOLI	1.77e-26	150	628	179	634	Alpha-xylosidase OS=Escherichia coli (strain K12) OX=83333 GN=yicI PE=1 SV=2
sp|Q9F234|AGL2_BACTQ	1.27e-24	105	627	142	638	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
sp|Q5AW25|AGDD_EMENI	5.15e-24	110	626	178	651	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.192444	0.807544	CS pos: 22-23. Pr: 0.2370

TMHMM  Annotations     

There is no transmembrane helices in EPrPAT00000024219-p1.