CAZyme Information: EPrPAT00000024143-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000024143-p1
• CAZy Family: GT61
• CAZyme Description: Glycoside hydrolase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
520		57453.57	5.0623

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0926:1683-3434(+)

Full Sequence      

MPSMRGIFQVVAVAVTLALSPSQAALECRQPNYVTRDGKIFSQDPATPGLENEITIRGVT
WSGMEKDNMIPDGLWGSTNPSAASVYGTKVSTLLEFLKNNSINSVRLPLNADFLIKNSFP
QLAYIHGYENRELTIWADPNSVTYFDLLGRMIQVLQTEKISVLLDINLLTNYPQDAFWYT
APYVNITESPTYKAVSYLAKAFCNSTYWNVLGIDLKDEMSDVLWNADPKEADVTNDWHGA
AEILANRVLELCPSWLVFVGGASSPTDAQRFSVGKDYETLSSHWDGGNLHNATKNPLKIN
TGNKIVFAPHAHSHGKLPQNYFYSANSNCTRNSPTDYYGLENSEIDSDKYSCTSTEFGCS
SYEHLTAETIAKNYQKVMDEAIGDVVKEGKTPVIFGSFSGVYGAQTQPHQTAALDFLINY
AATNLRGGYFWALNPDTEYFLEDSTNPKKGLFGKTHYGIFTARSWQVANEDLLTALAKIP
SSPIQCYGEKSKGKSDASPLRADVTVALGSAVVTMLYAMW

Enzyme Prediction     

No EC number prediction in EPrPAT00000024143-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	51	359	1.7e-69	0.8313953488372093

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.02e-14	40	446	31	377	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	0.010	92	436	28	271	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA26601.1|GH5_20	3.34e-64	28	492	142	569
ABL75347.1|GH5_20	1.11e-60	22	482	138	560
ABL75348.1|GH5_20	1.86e-57	22	479	139	558
CCA19804.1|GH5_20	3.71e-56	25	481	108	511
UIZ24458.1|GH5_20	6.43e-55	22	505	135	581

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VVG_A	6.33e-16	33	437	8	350	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3QHM_A	7.68e-16	33	437	41	383	Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHM_B Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHM_C Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]
2ZUM_A	1.02e-15	33	437	41	383	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3AXX_A	1.02e-15	33	437	41	383	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3W6M_A	1.13e-15	33	437	8	350	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P10474|GUNB_CALSA	1.12e-14	54	323	645	902	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000244	0.999753	CS pos: 24-25. Pr: 0.9757

TMHMM  Annotations     

There is no transmembrane helices in EPrPAT00000024143-p1.