CAZyme Information: EPrPAT00000024096-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000024096-p1
• CAZy Family: GT60|GT60
• CAZyme Description: Cell 5A endo-1,4-betaglucanase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
567		62556.22	4.7595

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0912:5507-7406(-)

Full Sequence      

MEEHAPLRAPESGRATFQNSEYPQGIHRQMSEDTDSGRFTLSQGPRPTEFKITAVEPDEG
APPERKRDYKGRIRTWPGILLLIGIVGAAAALITLGAIHSKDQSEALARTYEENVAGARR
IKDGLNSSDDIIDDDGQVGNPKKYPSMGCELPDYLSKGGQIWARSKNGTEVAVGIKGVNW
FGMETGVAVPFGLWENQENGTSAYEVASFLARNKFNSVRLPVCIKSILKDTPPQKDLVNL
NSNRALNITTYMSTIKTIVQSLAYRHVTVMISLHTLDPKESGGAWYSDDLGVSEDDFLKA
VDILTKNLCSSEYWNILGLDLKNEPHECSWGGADPDWQKGATLIGNRMLEGCPNWLAFVE
GINGNYKINLDGTSKVYYDWWGGGLEKAGANPVELKTDNKVVYAPHYYNTGVTPAWYLYG
GGTAGPDSTIVDYVELDDETLKFNVNATMWAMFSYLSARNKEAIILGEFAGLYATDKHPK
KTTKRTTDFTIQSAIATGLAGGYMWSLNPESAYQYNPADTKGTFTEGLLTDDWLTPDSEF
LTGMAALDQIRDLKMFPCFPEEVSSRN

Enzyme Prediction     

No EC number prediction in EPrPAT00000024096-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	170	511	8.5e-145	0.997093023255814

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	2.05e-15	175	534	47	390	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	7.07e-12	176	476	6	243	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABL75351.1|GH5_20	1.53e-285	9	565	18	577
ABC87086.1|GH5_20	5.28e-284	9	565	16	578
ABL75350.1|GH5_20	2.57e-282	9	565	18	579
ABJ97692.1|GH5_20	7.91e-282	9	563	18	575
ABC87087.1|GH5_20	1.04e-278	15	565	33	586

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VVG_A	1.00e-35	167	535	22	363	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3W6M_A	1.37e-35	167	535	22	363	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	4.00e-35	167	535	55	396	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3AXX_A	4.00e-35	167	535	55	396	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3QHO_A	1.39e-34	167	535	55	396	Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_B Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_C Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P19487|GUNA_XANCP	3.34e-29	173	547	42	368	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2
sp|P54583|GUN1_ACIC1	2.32e-27	158	538	43	382	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P10474|GUNB_CALSA	9.88e-23	173	524	645	1005	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000000

TMHMM  Annotations     

Start	End
76	98