CAZyme Information: EPrPAT00000024010-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000024010-p1
• CAZy Family: GT60
• CAZyme Description: Trehalose-phosphatase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
874		98902.44	6.0378

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0885:6006-8755(-)

Full Sequence      

MTFAASQAPSEPAESSLLDQLHDLHKKLAAVRQDSQRFNALSRNMGPIPMASETNKIIVC
SVRRCVRMVKTAHDDSWQYVPSDTGFKSAIDYLCETNNVQWITWPGAVVDESSQDGVRRK
LDAEYSCRPVFLTSETLDLYHNQFCNDILWPLFHSLPQRSDSRLLDNFTEKYDAYCTANQ
KFLEAVSEIYKEGDLVLVCDYQLMNLPGLLRRRFPDITCGFYFHSPFPSSEFFQMLPARE
ALLHGVLGADLVVFNHFDYVRHFLNVCTRMLGLESSPSRVEYNGRLISLGICPMGIDPRK
YETTPSVLQHVERIKSQHDGTKILVGVHKLDFCKGIPEMLEAMEYLLQHYPEYRGKVVLF
AVVRDAGRTASHQYKILNRQINELVGRVNGRFGTAEYCPIRYLKRSIDHDQLVALYNAAD
VAIITSIKEGINLQAMEFIAAQKENCHGVLVYSEFAGCASSFQGALLVNPMHIEQVAASI
DTALKMNTTTKRIRHHQLSRYVNTYTSTLWAQRIMSALNEAGTMAQEYNRLDKLDTAQLL
GYFERSRRRLFLLDYDGTLVQYQSMAELAQPTPALLACLEELASDPHNAVYIISGRDKAR
LHEWFGHIPRVGLAAEHGYWFRPAAKYGEGSRQKLPVDDDSNADKITVQSSGETGLVTAE
LSPERELDHGGLVPGSASVEPVGSGATLFDNVPWQCMVSDVELEWRDEVESILEHFTERT
PGSLLDVKDCCYTWHFRDADPTFGLKQAKDLQLHFDQMLRDRPVGVVMCRIKKYVMIRPW
RVNKGRAVSRILEYESETPYFTSLDFDFILAIGDERTDEDMFNVVQGSNCYTCTVGMKVS
RAQYYLDDPDEVLRVLTACTTLAAAGGDRGNLPG

Enzyme Prediction     

No EC number prediction in EPrPAT00000024010-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	53	519	5e-152	0.9747368421052631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	56	860	2	724	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	9.85e-178	56	519	1	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
215556	PLN03064	1.37e-163	55	822	101	807	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
395781	Glyco_transf_20	2.72e-161	74	520	21	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215555	PLN03063	5.52e-160	53	869	9	793	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29132.1|GT20	0.0	10	862	13	866
CCA19773.1|GT20	0.0	14	863	26	916
CCA26754.1|GT20	0.0	14	863	26	916
AJA04606.1|GT20	8.72e-175	8	856	59	873
AGT80036.1|GT20	8.72e-175	8	856	59	873

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVM_A	2.68e-118	69	519	25	475	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	4.47e-113	69	519	13	463	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	4.31e-110	69	518	24	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUV_A	1.96e-106	56	518	5	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	1.96e-106	56	518	5	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54K57|TPSA_DICDI	6.37e-170	54	852	15	727	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q54NU9|TPSB_DICDI	4.83e-134	87	856	81	784	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|Q0WUI9|TPS8_ARATH	6.10e-131	74	856	85	831	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana OX=3702 GN=TPS8 PE=2 SV=1
sp|Q9LRA7|TPS9_ARATH	2.35e-129	112	856	117	836	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana OX=3702 GN=TPS9 PE=2 SV=1
sp|O23617|TPS5_ARATH	5.70e-129	91	856	96	836	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 OS=Arabidopsis thaliana OX=3702 GN=TPS5 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EPrPAT00000024010-p1.