CAZyme Information: EPrPAT00000023737-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000023737-p1
• CAZy Family: GT57
• CAZyme Description: Endo-1,3(4)-beta-glucanase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
779		84351.14	7.1110

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0809:10505-12841(+)

Full Sequence      

MKPSVCTFVLGCAALWNYEAMKSVSAQDVIISRDSNSSSIVVVDKPSSTPPSVSPSATPS
VPSPSPVPTSTPSVSPTSNPPVSSSPSPAPTSSSQGPPVVGPPQQGAGMPPSTLIEPTDN
MKTFAPPKYIDPSIKNRAIPTNNWWGNIIAHDSNAFIQPVWSNPYAMQIIADSAPYGLAI
SYPYRSRVAGGSSGNSNANRYYAHGIVREFMFSAAEFSSKPTVQVADWADIGVKVQLKNG
AGQVETDLVSGMAYISAKYSGGLSPKLVSVASIQSVNGRSASGLGAITASKFEIVYNSGQ
KWVLYALSSDGQSEKPITLSVEAGSTLKSAGSFDGILRVALSLKDDWVPTLDKYKTCVVQ
GASVSIDSDSAYAFNWKTAGNCASGMLHYAMQHQLQTLDGSAQSVNGMIAFSATRGALQA
VVGGGGSPVWKFKESQAIAEDFYPSRKIPASVVQEQRILTQLQTDIASDWSIPVGGSYYF
NGKAAQKYASLCLMANDPAIVGSDKALLTTCLGKLRTVMAPFLGNTWTNKLQYDRVYGGI
VSSEGFVKNDLGADFGNTMYNDHHFHYGYWIYTAAMINLLDPTWSELPRLNTMATLLARD
VANFESDDQFFPRFRSFDWFRGHSYSHGVTPFADGKDQESTSEDINFSYGLYLLGKVTKN
ARMEAVGKLMARVNAHAIRTYFLIDDASQVHPESFKPNKVTGIFFDNKVDYATWFSAEKH
CIHGIQMIPISPMTEFVRGKQFVKQEWDEVLSKTAIVTKEDTSNSWLSLLYANYAAIDK

Enzyme Prediction     

No EC number prediction in EPrPAT00000023737-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	126	779	6.7e-177	0.9421221864951769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	1.60e-146	456	779	8	322	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	5.60e-136	98	778	38	721	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	6.65e-46	126	435	4	308	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20868.1|GH81	0.0	110	779	90	764
UIZ20872.1|GH81	0.0	110	779	90	764
UIZ20873.1|GH81	0.0	110	779	90	764
UIZ20875.1|GH81	0.0	110	779	90	764
CCA25006.1|GH81	1.92e-265	107	778	31	707

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.50e-94	127	778	17	689	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	2.57e-94	127	778	42	714	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	2.20e-91	127	778	17	689	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	4.49e-34	138	778	34	626	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	4.11e-24	141	729	51	604	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	3.24e-92	139	778	226	868	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	2.08e-87	139	778	35	668	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q12168|ENG2_YEAST	8.46e-77	132	778	101	744	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|P53753|ENG1_YEAST	5.79e-74	111	778	411	1077	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	7.28e-73	212	775	151	700	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.042866	0.957095	CS pos: 26-27. Pr: 0.7408

TMHMM  Annotations     

There is no transmembrane helices in EPrPAT00000023737-p1.