CAZyme Information: EPrPAT00000023634-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000023634-p1
• CAZy Family: GT48
• CAZyme Description: Mannosyl-oligosaccharide alpha-1,2-mannosidase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
320		36770.86	5.8116

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0783:12630-13592(-)

Full Sequence      

THEKGFASWANYRAYIADIGSLQLETRYLSDVTGNRTYAEMGEAFYSILQREGAFNGTGL
FPVKFDSKTGKFSEGSSTISIGAYGDSFYEYLLKVFIYSGKRDEDKFLRAFYDDAVRGME
EHLLQYSEPDKVYYLQELHVPSMSGVPRMDHLLCFVPGMLALGTLHEKVDIEKNARHLEL
AKKIAHTCYQMYHQQPTGLSPDVVQFPGMGIQDAKYRLRPETIESLFYLYRVTKDELYRD
LGWEIFQNLEKNAKVAFGYGAIENVGEMPPKVENKMESFFLAETLKYHYLLQAPLDVIPL
DEYVFNTEAHPLRILKASRV

Enzyme Prediction     

EC	3.2.1.113:99

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	7	314	2.1e-90	0.6905829596412556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	8.24e-125	1	314	130	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	2.16e-114	1	316	206	520	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD28123.1|GH47	7.22e-149	4	314	16	326
UIZ22976.1|GH47	4.01e-146	1	318	275	605
AIG55877.1|GH47	6.85e-99	1	268	215	489
CCD28278.1|GH47	1.32e-89	129	314	2	187
BDA46113.1|GH47	1.53e-71	8	316	299	606

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KIJ_A	6.30e-68	16	314	151	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase and Man9GlcNAc2-PA complex [Homo sapiens]
1FMI_A	7.31e-68	16	314	156	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase [Homo sapiens]
1FO2_A	7.68e-68	16	314	156	456	Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With 1-Deoxymannojirimycin [Homo sapiens],1FO3_A Crystal Structure Of Human Class I Alpha1,2-Mannosidase In Complex With Kifunensine [Homo sapiens]
5KK7_A	3.75e-67	16	314	151	451	Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens],5KK7_B Crystal structure of the class I human endoplasmic reticulum 1,2-alpha-mannosidase T688A mutant and Thio-disaccharide substrate analog complex [Homo sapiens]
1X9D_A	4.68e-67	16	314	234	534	Crystal Structure Of Human Class I alpha-1,2-Mannosidase In Complex With Thio-Disaccharide Substrate Analogue [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UKM7|MA1B1_HUMAN	4.89e-65	16	314	395	695	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
sp|Q8H116|MNS2_ARATH	7.79e-64	8	314	238	537	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
sp|P53624|MA1A1_DROME	2.22e-63	5	318	345	651	Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Drosophila melanogaster OX=7227 GN=alpha-Man-Ia PE=2 SV=2
sp|Q93Y37|MNS3_ARATH	4.06e-63	17	314	292	620	Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 OS=Arabidopsis thaliana OX=3702 GN=MNS3 PE=1 SV=1
sp|B2GUY0|MA1B1_RAT	7.37e-62	16	314	353	653	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Rattus norvegicus OX=10116 GN=Man1b1 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EPrPAT00000023634-p1.