CAZyme Information: EPrPAT00000022270-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000022270-p1
• CAZy Family: GT22|GT22
• CAZyme Description: Alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1007		113099.67	5.3136

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0559:3320-7363(-)

Full Sequence      

MKSSSAMRSRKRSVSLEEDIFASATGNAGFVSASASSSPTRRQHASTEASQASMSLRLEQ
QHMARQQQVQRENYGDNEEEESDEEASSSDDDDGDSSSEEDDDEDASSSEASVGIDDLTS
MAQRRDSPVAAAAVPITNTMVRSRSASSRAMSGVFTYDDDDAVDMNAREQELLVNIQEIQ
RQLSMVQIQTEKPPEEILPPMGDSRHRLIMVSNRLPISFQRNETTGEWSFKMSSGGLVTA
LNGIRDEVPFIWIGWLGEEIAHEDQNKVREKLAQEFNCVPVFLSKEIASRYYNDFSNDIL
WPIFHYVPLPLFRAGSEKKFDFRLWDAYKLANKRFAQAVNQVYREGDYVWVHDYHLMMLP
SLLRKRHPKCKIGWFLHTPFPSAEMYRSLPVGKQILEGLLGADLLGFHTYDYARHFLSAC
SRIPGATSSPKGIEWEDHFSAVGVFPIGIDPEHFENILGANETKQRIMELTEKFKDCKVI
IGVDRMDYIKGIPHKLLAMERFLSMYPERRESVVLIQIAVPSRTGVIEYQNLAASVNEMV
GRINGRYGTLQHSPVHYIHRSISPTELVALYNLADVCLVTSIRDGMNLVSHEYVMCQSQP
CEPHREGPGVLILSEFAGSAQSLSGAIRVNPWNTSDIASALEYALTLPLMEREYRQTNLH
RYVKTHTASFWGKSFLSDLEYTVSRPSSSRKLVKLPTIDVMNAYARSKRRMIVLDYEGTL
LEEAHQRATIAPPKPFVKRIIESLAADRKNTVLLVSGHERGVIGSWLNDRRIGVVAESGY
FYRLPHTDEWEMMTEDHDPSWKKVVRPIMQYFTERTPGSFIETKESSLTWHYGETDPIFG
PMQARDMQVNLEDVLCSLPLEVLQGTNRVEVRLQGITKTVIIEEILKMYEQHPTSPVTLA
VRGGSPSSRTPGKPQAGVPQIDFVFCAGNGLEDDDLFTFFQEFQDHAAQEASRMAAVSTA
PSTPAKSPLLTSLPPGVARPPAPVPVPYPSSCEEDVGGFDDVSPQVT

Enzyme Prediction     

EC	2.4.1.15:146

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	205	680	6.6e-196	0.9726315789473684

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395781	Glyco_transf_20	0.0	207	681	2	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
223457	OtsA	0.0	200	688	11	486	Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism].
177855	PLN02205	0.0	177	937	25	797	alpha,alpha-trehalose-phosphate synthase [UDP-forming]
215556	PLN03064	0.0	158	941	46	811	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
340820	GT20_TPS	0.0	207	680	1	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA16456.1|GT20	0.0	159	952	121	893
CCA20339.1|GT20	0.0	158	945	33	803
UIZ21560.1|GT20	0.0	116	680	90	653
QOX06485.1|GT20	9.57e-254	199	943	68	780
AJA04606.1|GT20	2.11e-245	169	943	65	837

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HUV_A	5.10e-172	207	679	5	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	2.02e-171	207	679	5	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
6JBI_A	1.43e-170	207	679	1	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVM_A	2.02e-170	207	679	13	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HVO_A	2.76e-165	202	679	7	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54K57|TPSA_DICDI	6.08e-228	207	876	17	664	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q9SYM4|TPS1_ARATH	1.39e-195	204	941	90	809	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Arabidopsis thaliana OX=3702 GN=TPS1 PE=1 SV=1
sp|Q9FZ57|TPS2_ARATH	1.10e-185	205	941	11	723	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Arabidopsis thaliana OX=3702 GN=TPS2 PE=3 SV=1
sp|O23617|TPS5_ARATH	3.58e-178	200	948	54	803	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 5 OS=Arabidopsis thaliana OX=3702 GN=TPS5 PE=1 SV=2
sp|P40387|TPS1_SCHPO	2.33e-177	202	707	13	513	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tps1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000039	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EPrPAT00000022270-p1.