CAZyme Information: EPrPAT00000021904-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000021904-p1
• CAZy Family: GT20
• CAZyme Description: GPI mannosyltransferase 1.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
428	PaphDAOMBR444_SC0513|CGC1	48078.28	8.6085

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0513:10488-12205(+)

Full Sequence      

MTIMRKSSVFGAALLLRLALIAYGAFQDAYFPVKYTDVDYDVYTDAAREVASGNSPFDRT
TYRYTPVLCVSYLLAPSSAYLLLPNIFVHEVFGKLLFVAADLLAGLVLLQILQLRGLPTD
SALRYCCVWLFHPFSINISTRGNADSIVVLLVLLSLLLIMRKQVVLSAIAYGASVHFKIY
PIVYALAFLVFLNGDFNRANAKWSSSCQSSFCVWIQLAGQLNRDRIVFGLVSGGLFLSLI
GIFYQMYGFQFLHEAYLYHFTRTDNRHNFSVYFYDLYLRYNTPSGFGIGLLAFLPQLVSL
VTLSLAYGRDLSFALFALTMVFVIFNKVCTAQRSPSHLPNDKSPIALEGPALIASWFGTE
LHWLFWAFHLEMKGMNTFLPLWVAGLLFFTVNVAILATLMRNHLYTPLFRDGSIVLLESA
HASNAKSD

Enzyme Prediction     

No EC number prediction in EPrPAT00000021904-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	138	399	3e-79	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	2.39e-117	23	415	25	430	GPI mannosyltransferase
252941	Mannosyl_trans	1.40e-58	138	400	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA18245.1|GT50	1.08e-138	13	414	12	407
VDD20265.1|GT50	1.21e-104	8	410	5	409
BBN20063.1|GT50	2.29e-104	5	412	35	440
VDC86084.1|GT50	8.40e-103	12	410	23	423
CAG7892072.1|GT50	8.40e-103	12	410	23	423

PDB Hits     

EPrPAT00000021904-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q500W7|PIGM_ARATH	1.41e-101	4	424	16	444	GPI mannosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=PIGM PE=2 SV=1
sp|Q54IA4|PIGM_DICDI	2.49e-97	8	403	27	430	GPI mannosyltransferase 1 OS=Dictyostelium discoideum OX=44689 GN=pigm PE=3 SV=1
sp|Q9H3S5|PIGM_HUMAN	1.58e-96	7	408	19	416	GPI mannosyltransferase 1 OS=Homo sapiens OX=9606 GN=PIGM PE=1 SV=1
sp|Q5RAH7|PIGM_PONAB	1.58e-96	7	408	19	416	GPI mannosyltransferase 1 OS=Pongo abelii OX=9601 GN=PIGM PE=2 SV=1
sp|Q66IJ4|PIGM_XENTR	3.13e-95	9	403	17	409	GPI mannosyltransferase 1 OS=Xenopus tropicalis OX=8364 GN=pigm PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.244817	0.755173	CS pos: 24-25. Pr: 0.6832

TMHMM  Annotations     

Start	End
7	26
62	84
91	113
170	192
226	248
285	307
312	334
344	366
378	400