CAZyme Information: EPrPAT00000021213-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000021213-p1
• CAZy Family: GH89
• CAZyme Description: Cutinase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
219	PaphDAOMBR444_SC0433|CGC1	22891.10	6.6935

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0433:25615-26309(-)

Full Sequence      

MAFSLSLTLPRLLIVATLLYARAQSQCTDVHVVFARGSTELPGLGICGTPLVSGMTHYLE
NIPLSVSSYAVNYLADAAQTSAGPGATDMTNHIVQYAAQCPNSSFVIGGYSQGASVTDIA
IGIDTKLGKGSVISTDLASRIKAVVTFGNPLKLYGQTISSASQLYGTKSIDFCNKGDPYL
TDGSVTKAALRAAMLVQGENDTLTTGEEFSFSKIIFGAK

Enzyme Prediction     

No EC number prediction in EPrPAT00000021213-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE5	26	182	2.6e-41	0.8518518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395860	Cutinase	2.11e-36	26	185	1	150	Cutinase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAX55266.1|CE5	2.63e-77	25	198	26	210
AAO92431.1|CE5	2.12e-75	6	198	8	211
AAO92430.1|CE5	2.12e-75	6	198	8	211
EEY60079.1|CE5	8.80e-73	24	198	24	208
AAY43367.1|CE5	1.73e-72	24	201	24	211

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1BS9_A	6.42e-11	27	184	2	182	Acetylxylan Esterase From P. Purpurogenum Refined At 1.10 Angstroms [Talaromyces purpureogenus]
1G66_A	6.42e-11	27	184	2	182	ACETYLXYLAN ESTERASE AT 0.90 ANGSTROM RESOLUTION [Talaromyces purpureogenus]
4PSC_A	7.03e-10	27	185	79	224	Structure of cutinase from Trichoderma reesei in its native form. [Trichoderma reesei QM6a],4PSD_A Structure of Trichoderma reesei cutinase native form. [Trichoderma reesei QM6a],4PSE_A Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a],4PSE_B Trichoderma reesei cutinase in complex with a C11Y4 phosphonate inhibitor [Trichoderma reesei QM6a]
2AXE_A	8.21e-10	27	184	2	182	Iodinated Complex Of Acetyl Xylan Esterase At 1.80 Angstroms [Talaromyces purpureogenus]
4OYY_A	2.48e-09	27	199	17	183	Humicola insolens cutinase [Humicola insolens],4OYY_B Humicola insolens cutinase [Humicola insolens],4OYY_C Humicola insolens cutinase [Humicola insolens],4OYY_D Humicola insolens cutinase [Humicola insolens],4OYY_E Humicola insolens cutinase [Humicola insolens],4OYY_F Humicola insolens cutinase [Humicola insolens],4OYY_G Humicola insolens cutinase [Humicola insolens],4OYY_H Humicola insolens cutinase [Humicola insolens],4OYY_I Humicola insolens cutinase [Humicola insolens],4OYY_J Humicola insolens cutinase [Humicola insolens],4OYY_K Humicola insolens cutinase [Humicola insolens],4OYY_L Humicola insolens cutinase [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A6WFI5|CUTI_KINRD	1.47e-49	27	204	36	226	Cutinase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) OX=266940 GN=cut PE=1 SV=1
sp|P0A537|CULP3_MYCBO	9.83e-32	27	178	44	193	Probable carboxylesterase Culp3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) OX=233413 GN=cut3 PE=3 SV=1
sp|P9WP38|CULP3_MYCTO	9.83e-32	27	178	44	193	Probable carboxylesterase Culp3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=cut3 PE=3 SV=1
sp|P9WP39|CULP3_MYCTU	9.83e-32	27	178	44	193	Probable carboxylesterase Culp3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut3 PE=1 SV=1
sp|O06319|CULP4_MYCTU	1.50e-28	23	190	43	208	Phospholipase Culp4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=cut4 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000238	0.999758	CS pos: 25-26. Pr: 0.9103

TMHMM  Annotations     

There is no transmembrane helices in EPrPAT00000021213-p1.