CAZyme Information: EPrPAT00000018889-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000018889-p1
• CAZy Family: GH37
• CAZyme Description: Glucan 1,3-beta-D-glucosidase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368		40396.04	4.3411

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0228:4543-5649(+)

Full Sequence      

MVRVLPTLAVVASFLAPVLAQDFKLYGINYNIRAGPDAAPPAEKCKSATQIEKELQILKS
VTDIVRIYSLVDCDQATAAVPAIINAGLKLELGLWVGPNNDVYAAEREKFKELVKNTALV
NSTSVVSIHVGSEAIYREDVNASTAIANLHEIKQIAADANLTVPVSIGDIGDSYLAYPDL
FKEVDFVSANLFPFWEKVEADKAADHFYERYQKVATEAAKYNKTVVIGETGWPTNGTHAG
ASKASPENAATFFSDFYTLAKEHDLNYYYFAGFDEAWKLHNEAADSTVEGYFGIFTADGV
LKPEFAELKLDSDDSDDSINADAEEAGETEEEGDDEASEDEDDDNTLPLKTKPPVKKLHI
KVKFNKHH

Enzyme Prediction     

No EC number prediction in EPrPAT00000018889-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	44	301	1.9e-26	0.9421221864951769

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	2.81e-50	45	298	59	304	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
366033	Glyco_hydro_17	1.43e-17	27	302	2	304	Glycosyl hydrolases family 17.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAJ90910.1|GH17	1.17e-104	1	320	1	328
UIZ28880.1|GH17	2.12e-104	20	302	11	294
AAM18482.1|GH17	2.76e-104	1	306	1	310
AIG55390.1|GH17	2.55e-88	20	310	22	311
AIG56392.1|GH17	1.03e-87	3	310	2	308

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	2.87e-35	26	303	38	290	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	2.11e-34	26	303	38	290	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]
6FCG_A	6.31e-07	43	302	139	380	Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_B Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_C Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_D Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_E Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131],6FCG_F Crystal structure of an endo-laminarinase from Formosa Hel1_33_131 [Formosa sp. Hel1_33_131]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P15703|BGL2_YEAST	2.08e-28	45	302	40	305	Glucan 1,3-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BGL2 PE=1 SV=1
sp|Q5AMT2|BGL2_CANAL	6.97e-28	15	302	9	300	Glucan 1,3-beta-glucosidase BGL2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BGL2 PE=1 SV=2
sp|P43070|BGL2_CANAX	9.66e-28	15	302	9	300	Glucan 1,3-beta-glucosidase OS=Candida albicans OX=5476 GN=BGL2 PE=3 SV=1
sp|D4B2W4|BGL2_ARTBC	6.30e-25	41	310	33	303	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
sp|A2QN74|BTGC_ASPNC	2.12e-24	22	303	384	671	Putative glucan endo-1,3-beta-glucosidase btgC OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=btgC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000212	0.999755	CS pos: 20-21. Pr: 0.9785

TMHMM  Annotations     

There is no transmembrane helices in EPrPAT00000018889-p1.