CAZyme Information: EPrPAT00000018672-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000018672-p1
• CAZy Family: PL3
• CAZyme Description: Glycosyl transferase group 1.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
507	PaphDAOMBR444_SC0214|CGC1	57955.78	7.4231

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0214:35208-36731(+)

Full Sequence      

MALSMGASTGSSYLLHACILLLLLILSLVQIAFFAFLPDVHLHADFCNASIATLTLTAPT
SPELETPVHLLYRSLYLSPKEIVAREKLQREQLEQELAMAALSSKNTPKIRGDKKAHATR
IDEAKKRLEIIERQKKAAIDRSFFLQTQGQGHEPLNSTSTYCINLITPSDSPGVLHDFEI
YLNALPSSRPVYATDGKVELPPSVIDFYLERHPVDKKYYSQFKHPKDKTIWMMQNTEFFD
RHELANPDVGVMIVKNRIGLKKVLEYRHRHKMGYTVFYTKHTSHDVYRPEVERDWTSFLH
LAGWSPFKNTKVIVKAWARHPEWPKLVLRVIKEDICAWIEENFGAPDGSGALRLVNVDYK
CGSEADDVKIQLQNKIGLHLCPSETEGFGHYINEARSAGALIMSTDVGPMNELVDDKSGV
LIGRAKPWWWQTKGDLFMPMAHVEIEDVERGVEKILLMTVEERQRMGRRARAKYLEDRTY
FLNAMAAVESSLCQDEIRIDKLQPYLY

Enzyme Prediction     

No EC number prediction in EPrPAT00000018672-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340831	GT4_PimA-like	3.64e-09	298	487	195	359	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
340836	GT4_WbnK-like	9.37e-08	378	492	267	360	Shigella dysenteriae WbnK and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. WbnK in Shigella dysenteriae has been shown to be involved in the type 7 O-antigen biosynthesis.
395425	Glycos_transf_1	2.21e-06	308	471	15	156	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
223515	RfaB	2.48e-06	298	477	202	360	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
340837	GT4_CapM-like	1.28e-05	382	477	270	347	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA20002.1|GT4	1.21e-198	11	507	12	470
UIZ29740.1|GT4	3.01e-196	70	507	3	468
AOG11380.1|GT4	4.55e-31	272	486	117	312
QHB73863.1|GT4	1.10e-30	271	492	114	316
QGG91159.1|GT4	4.25e-30	272	486	117	312

PDB Hits     

EPrPAT00000018672-p1 has no PDB hit.

Swiss-Prot Hits     

EPrPAT00000018672-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999999	0.000010

TMHMM  Annotations     

Start	End
12	34