CAZyme Information: EPrPAT00000018411-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000018411-p1
• CAZy Family: GH31
• CAZyme Description: Endo-1,3(4)-beta-glucanase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
692	PaphDAOMBR444_SC0199|CGC1	77762.48	6.6624

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0199:36751-38951(+)

Full Sequence      

MKLTWLGIVGLLPFLVTSAAEVQDTWEYGDLTPPQSLVTHTTAQTTLCAPRNIEIANGRP
IPTNSWWGNLITCDQTSNVTQPIWPNPFAISLETFYGHVAHKEVLFSATEFAKTQPTLRV
SDWTDLGVTVSMTISPTSPMALESTIVSGMAFFTATYTQLSPRIAIQVPMQSINSVTSVT
QGTLISGRKFVINTVSGLQWVLYTSSDVTFTVESNQILRTMATFTGTIRLAPVLAETPIV
MYDIYKDCIVQGGNTTVVTDSQYKFQWITSGDCSRGMLHYALPHQRETLDPSSVSEISGG
EMRALVTKTSPPVWIFNEKASIPITFYPRRRLTSTDATQQQLFDNLKADIMASWTIPLLG
SFYFSGKAAQKYASLCLMANDPVIVGTDVSLLRRCLTKLESVIAPLLDNSWFYPLQYDRV
YGGIVSSEGFTTGDMNADFGNTVYNDHHYHYGYWVYSAAVINFLHPTWSRLSELNRMTRL
LLRDVATPNNVDPFFPKFRAFDWFRGHSYSHGVTTFADGKDQESTSEDVNFAYALYLYGH
ATGHSRMASIGKLMVKVNARAIQRYFLMEKTNSVHPESFKLNKAPGIFFDNKVDYATWFS
AEKYCIHGIQMIPITPVTDFVRTRTFVQEEWDAVLSRETIVTTTDVSNPWLSLLYANYAR
IDRARALSVLQQTQLDDGLTRSWALYMGTQLY

Enzyme Prediction     

No EC number prediction in EPrPAT00000018411-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	56	686	1.9e-169	0.9742765273311897

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	1.43e-157	346	685	18	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	5.27e-141	60	687	89	751	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	3.08e-35	50	325	4	313	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA25009.1|GH81	1.20e-256	24	687	64	784
UIZ20868.1|GH81	1.19e-239	31	687	88	788
UIZ20873.1|GH81	9.62e-239	31	687	88	788
UIZ20872.1|GH81	1.36e-238	31	687	88	788
UIZ20875.1|GH81	1.36e-238	31	687	88	788

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.01e-93	50	687	30	714	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.71e-93	50	687	55	739	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	2.98e-90	50	687	30	714	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.78e-26	61	682	35	647	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	3.71e-19	445	613	439	604	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	4.83e-92	60	687	34	698	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	8.46e-82	141	692	182	738	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	7.74e-79	55	685	428	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	3.19e-78	52	685	218	896	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q12168|ENG2_YEAST	2.69e-77	52	685	102	772	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000223	0.999747	CS pos: 19-20. Pr: 0.9765

TMHMM  Annotations     

There is no transmembrane helices in EPrPAT00000018411-p1.