CAZyme Information: EPrPAT00000018350-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000018350-p1
• CAZy Family: PL3
• CAZyme Description: Cellulose synthase 2.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
971	PaphDAOMBR444_SC0195|CGC1	110621.20	6.8286

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0195:25925-29100(+)

Full Sequence      

MAHQADEYEMYATPSAMEAEISRRGTENNVRMTEGRPVPQQGYVDPRAPPQPPVNMSEAV
GLGGMRDNIISVHGYMHKQGKRTIKGPIHKSWKRRYFALEKAKIYYFHSHLDCRQYFTTR
NAELVVGAVELKDALQLRPCARLDLPHKGFEIHTKRRVWVLCPETDEEYRMWFQGLEHAI
ISNGAGNIIERKLPNVRKYQMKGITTYRILYFLFIIAGIVEILGVIFWFVVGLEPCDAAR
PSVDCATIQQTSLISLRCTDRPFSGWFTPPSWYLTVAGVDDVMCFHDPPIPQWISYFALL
FAEVLSFILAVFYYLGMWKPVRRGAHYFDEFEPKVPDEQWPRVDMLLCHYSEPAEECIDT
LMACMNIQYPPHLLHIFILDDGYCKAKWTKGNPVPQIELNKGILETAGDLRQEVAQFMYD
RVCDPNEEMEPETHYSKAGNINNCLYNEGANGRYLVILDTDMQPHQKFVLATLPFFFEDP
DRSDKTKYTCCCTGCNNVAKMCCASCKLASVPEERISYCSKECFENAMHVQSDIHRRQVN
GTLGETRDTKKELRCVNCDTKLGKSGVCKKCNGQMVDEDGEMASLHRYSDDVKDNAVAFV
QTPQYFRDCIQLQIGDPMGHRNATFYDAIQTGQDGYECASFAGTNAMFRREALDSIGGIQ
YGSLTEIVSPLCAMGWKALYFRKDFEGEANERIRLAEGLIPDSVAGSLAQRKRWAKGNFQ
IFLMNKKKNYIDPEWKKPEVQVPEYNKPNNFMRRVFYVNGTLYPLGSISAVLFFYITIYF
LFSGYAPIYMSGLRLLIALVPKLLIQGMLSALCNRTVENNDIVRSQETWFAYAFTNCTAV
LEALWWKLTGLEPRWFNTGGAARGSTAELPNVVIFLGTCVGVAWAVVRFFTGYNIEQTSH
GASLLFASVVMGLFIAFKLGPSVRMSIQEYFGWSYQSLMDEGNFLGYVAIAFGIQFIAFW
VFVEKPSSNPF

Enzyme Prediction     

EC	2.4.1.12:3

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	4.47e-41	341	722	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
236918	bcsA	2.48e-18	299	807	223	569	cellulose synthase catalytic subunit; Provisional
133057	CESA_NdvC_like	1.52e-11	585	724	102	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
275388	PH	8.41e-11	73	176	2	92	Pleckstrin homology (PH) domain. PH domains have diverse functions, but in general are involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. Less than 10% of PH domains bind phosphoinositide phosphates (PIPs) with high affinity and specificity. PH domains are distinguished from other PIP-binding domains by their specific high-affinity binding to PIPs with two vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which results in targeting some PH domain proteins to the plasma membrane. A few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes.
214574	PH	2.10e-10	73	180	4	101	Pleckstrin homology domain. Domain commonly found in eukaryotic signalling proteins. The domain family possesses multiple functions including the abilities to bind inositol phosphates, and various proteins. PH domains have been found to possess inserted domains (such as in PLC gamma, syntrophins) and to be inserted within other domains. Mutations in Brutons tyrosine kinase (Btk) within its PH domain cause X-linked agammaglobulinaemia (XLA) in patients. Point mutations cluster into the positively charged end of the molecule around the predicted binding site for phosphatidylinositol lipids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEZ51038.1|GT2	0.0	1	971	1	1025
ABP96907.1|GT2	0.0	6	971	13	1026
UIZ24309.1|GT2	0.0	6	971	4	1019
ABP96903.1|GT2|2.4.1.12	0.0	6	971	13	1026
ABP96911.1|GT2	0.0	6	971	13	1028

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	1.68e-16	288	801	79	441	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.84e-16	288	801	91	453	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.84e-16	288	801	92	454	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
7LBY_A	2.32e-15	299	929	236	692	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9U720|DCSA_DICDI	8.33e-18	588	835	642	878	Cellulose synthase catalytic subunit A [UDP-forming] OS=Dictyostelium discoideum OX=44689 GN=dcsA PE=1 SV=1
sp|P37653|BCSA_ECOLI	1.18e-14	299	929	236	692	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
sp|Q8X5L7|BCSA_ECO57	1.55e-14	299	929	236	692	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
sp|Q8Z291|BCSA_SALTI	6.10e-14	299	929	236	692	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1
sp|Q93IN2|BCSA_SALTY	6.10e-14	299	929	236	692	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000000

TMHMM  Annotations     

Start	End
209	231
293	315
755	777
792	814
869	891
901	923
944	963