CAZyme Information: EPrPAT00000018188-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000018188-p1
• CAZy Family: GH3
• CAZyme Description: Endo-1,3(4)-beta-glucanase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
830		92064.87	5.3417

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0185:30482-32974(-)

Full Sequence      

MKIVVWLALAAGAATAAHAGESFDFDDLQDETSVRSSLDDVKQIARPTPAAVTTIDDAKQ
IARPTPTPAPVPAPTPVRTPVPTPDATPVVTPKTKPVTKKPTPAPIPEEPTDEDGNAAQQ
TTDSVLRPFSTEPPAEMFKRSDGLATLAPIINVKQELLTTRAIPTNKWWGNLIHTTDKEK
GVHSNPAWSNPYALKLPVGKEGPYGLQACYSYTYRRKADKKDDKIKFYLHEYHNDLTLSA
AEFTEVPTYEVYDWTDMGINLKICNGDKCMDSALLNGMAFISTEYDGLTPYINSASKITK
FDEANGKYVIELSNKQTWVMYTSTPGKFTVDNTTIKATGPYTGTIRVAVIPEEASPDVYD
AYAGCIVKGGSVSVESRTQYSLNWHVEGSSCGNEGLLHFAFQHHLDSLNTEGGSTQSANA
SIVLQSTVRGSMTGHVVKATTGDIAKWVLQEPELKEDISFYAPRKVDAAIVQQLQLKEKL
AEDINSDWTIDGVSYYFSGKAYQKYASLCLMADDPMIVGNDRALLKICVTKLEGILDKFL
SNSFSSPLIYDTTYRGITTSEAITKKDVNADFGNGIYNDHHYHYGYWITASAMLRKLDPK
WSRMEELDSIIWTMLRDVANPSPDDVHFPTFRHFSWFLGHSYSHGVTPLADGKDQESTSE
DINFHYGMMLWGQVTGNKAVEDLGSLMLRIDAHAIRTYFLMDSSNKIHPPEFVKNHVTGI
FFDNKVDYATWFSGEKYCIHGIQMIPVSPINEIVRTPTFVKEEWDDVLSKESIVVGKDLT
NAWNSLLYANYAAVNKQEALSVLQEVKLDDGLTRSWALYIAATRASTSVV

Enzyme Prediction     

No EC number prediction in EPrPAT00000018188-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	158	819	1.3e-177	0.9742765273311897

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	2.57e-142	93	822	41	753	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	5.47e-142	480	818	18	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	2.09e-50	159	460	11	316	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26438.1|GH81	6.42e-313	128	828	47	744
UIZ26440.1|GH81	6.42e-313	128	828	47	744
UIZ26131.1|GH81	2.51e-265	123	826	10	716
UIZ26137.1|GH81	1.36e-264	123	826	120	826
UIZ26602.1|GH81	1.36e-264	123	826	120	826

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XBZ_A	1.22e-105	115	824	21	743	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K3A_A	1.84e-105	161	824	39	718	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
4K35_A	1.50e-101	161	824	39	718	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	3.18e-35	125	815	13	647	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	3.84e-29	123	810	25	664	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	2.28e-101	125	822	3	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	1.41e-92	110	829	178	907	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q12168|ENG2_YEAST	5.45e-86	123	818	54	772	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|P53753|ENG1_YEAST	2.88e-81	124	827	401	1115	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	1.81e-80	118	828	421	1145	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000299	0.999670	CS pos: 19-20. Pr: 0.9625

TMHMM  Annotations     

There is no transmembrane helices in EPrPAT00000018188-p1.