CAZyme Information: EPrPAT00000017740-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000017740-p1
• CAZy Family: GH17|CBM13
• CAZyme Description: Beta-galactosidase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
837		95201.28	6.4780

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0161:42083-44723(-)

Full Sequence      

MEPERAEDAPLLSPEDGFCREERSASAERRAHARGWRMRRADLALVTVLCMAASFVSVWK
PTEKPVGALWRHYLKQLEAKYAKDGQMQFQYMTYDDIDEHKRETGYAVTYSPRGFVIDGK
ATLLLGGSIHYPRSTPRMWEDLMRKAKNDGLNHIELYIFWNVHEPTRDTFHLGGNANITN
FYDIAVRLGLFLHVRFGPYACAEWNNGGLPYWLDAIPGMDVRSSSAPWMSEMRRFVKKMV
EISRPYLAENGGPIIMAQIENEYNGDDNDYVAWCGDFVRELDTKIPWVMCNGKAANNTIL
ACNGNDCVDFAETQASLRPSDPFMWTEDEGWYQTWELKADDGGDVQQDDYNRAPDEVAYA
IARWFAVGGAHHNYYMYHGGNNYGRSAAAGVTTKYADGVNLHHDGLSNEPKRSHLRTLHH
ALIDCNEVLLENERQIHHAIPLSAPNTQAFVYGRGDNSVSFLENAGASPVDVVYDGSSYH
LEPKSMLILKNKTAIFYTADVRASYPHRQMRVYTELVPAPGLKWDIWTESGDQRKVLVDK
KPLEQLSVTADRTDYLTYETTFTVNDNVITKNGDLTLKFTACDANGFAIFVNDLFIEEVH
RGYPGENCSVPFSVKLPSWVSSADTNKGTRRLSIVSVSLGLFSLGKNHHKGITGDVTLND
KQSLIGESKWKMYPGLMGEHLKIYDPKWMASVPWDRYERDNTTYPAMSWYRTSFILPRPP
KDIRAKPVEETKSILVDCVGLTRGRVFLNGHDLGRYWLIRNTSGDYVQRYYHVPPDWLQK
NPRERNSLVVFDEMGGSIRDVRVVLSTMLDDYLDPAREIVANFKSHSSAVASTERRP

Enzyme Prediction     

No EC number prediction in EPrPAT00000017740-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	115	420	2.3e-88	0.993485342019544

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
166698	PLN03059	1.41e-127	107	808	29	728	beta-galactosidase; Provisional
396048	Glyco_hydro_35	6.90e-96	115	420	2	316	Glycosyl hydrolases family 35.
224786	GanA	1.92e-18	108	274	1	171	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
199880	E_set_Chitinase_N	0.004	500	586	19	95	N-terminal Early set domain associated with the catalytic domain of chitinase. E or "early" set domains are associated with the catalytic domain of chitinase at the N-terminal end. Chitinases hydrolyze the abundant natural biopolymer chitin, producing smaller chito-oligosaccharides. Chitin consists of multiple N-acetyl-D-glucosamine (NAG) residues connected via beta-1,4-glycosidic linkages and is an important structural element of fungal cell wall and arthropod exoskeletons. On the basis of the mode of chitin hydrolysis, chitinases are classified as random, endo-, and exo-chitinases and belong to families 18 and 19 of glycosyl hydrolases based on sequence criteria. The N-terminal domain of chitinase may be related to the immunoglobulin and/or fibronectin type III superfamilies. These domains are associated with different types of catalytic domains at either the N-terminal or C-terminal end and may be involved in homodimeric/tetrameric/dodecameric interactions. Members of this family include members of the alpha amylase family, sialidase, galactose oxidase, cellulase, cellulose, hyaluronate lyase, chitobiase, and chitinase, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26848.1|GH35	2.87e-285	37	809	25	796
CCA17560.1|GH35	4.05e-249	40	808	40	794
UJR36785.1|GH35	4.36e-146	99	807	25	735
ACD54699.1|GH35	3.14e-142	92	797	22	721
ACD54708.1|GH35	7.40e-140	92	797	22	721

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5F_A	1.23e-111	103	804	3	703	Chain A, Beta-galactosidase [Solanum lycopersicum],3W5F_B Chain B, Beta-galactosidase [Solanum lycopersicum],3W5G_A Chain A, Beta-galactosidase [Solanum lycopersicum],3W5G_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK5_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK5_B Chain B, Beta-galactosidase [Solanum lycopersicum]
6IK6_A	9.26e-111	103	804	3	703	Chain A, Beta-galactosidase [Solanum lycopersicum],6IK6_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK7_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK7_B Chain B, Beta-galactosidase [Solanum lycopersicum],6IK8_A Chain A, Beta-galactosidase [Solanum lycopersicum],6IK8_B Chain B, Beta-galactosidase [Solanum lycopersicum]
4MAD_A	1.92e-40	115	384	24	294	Chain A, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
6EON_A	5.56e-34	115	810	35	610	Galactanase BT0290 [Bacteroides thetaiotaomicron VPI-5482]
4E8C_A	1.36e-33	115	384	10	284	Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8C_B Crystal structure of streptococcal beta-galactosidase in complex with galactose [Streptococcus pneumoniae TIGR4],4E8D_A Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4],4E8D_B Crystal structure of streptococcal beta-galactosidase [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9MAJ7|BGAL5_ARATH	2.82e-114	107	804	30	727	Beta-galactosidase 5 OS=Arabidopsis thaliana OX=3702 GN=BGAL5 PE=2 SV=1
sp|Q10RB4|BGAL5_ORYSJ	6.69e-109	107	808	26	726	Beta-galactosidase 5 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0165400 PE=2 SV=1
sp|A2X2H7|BGAL4_ORYSI	1.90e-107	107	807	37	728	Beta-galactosidase 4 OS=Oryza sativa subsp. indica OX=39946 GN=OsI_006270 PE=3 SV=1
sp|P45582|BGAL_ASPOF	2.98e-107	107	804	26	716	Beta-galactosidase OS=Asparagus officinalis OX=4686 PE=2 SV=1
sp|Q6Z6K4|BGAL4_ORYSJ	3.71e-107	107	807	37	728	Beta-galactosidase 4 OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0219200 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999969	0.000043

TMHMM  Annotations     

There is no transmembrane helices in EPrPAT00000017740-p1.