CAZyme Information: EPrPAT00000017417-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000017417-p1
• CAZy Family: GH16|GH16
• CAZyme Description: GlcNac transferase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
930		103838.62	8.5982

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0144:1180-4548(+)

Full Sequence      

MRVLALLVALTAAAVGVQAEGKMESTLHLEKDRKVTLDPSVQHIPLDPALAQLRPPPARV
PDKFDIFIGLSVFRDGYRCAKTIFTGFTRSTNPERLYFGVVDQVNPGDAKCIDEYCKMAA
AHWPDKGPCYLGDHVRIDERSADDSRGPTLARHYQQKLVRDEEFCLQLDGHSIFTNQWDK
YMLEEWKRLDNEMAVLTTYLHHINDFVKENGDNNAPAGWLPHLCTTMRGGNGCVRNIGAS
MISGSKWPQMSALWGAGLSFSKCHAERRVLIDSHTLWMFDGEEFLRASHLWTHGYDLYSP
SPLGSVVYHNYSKVPARFEHVKVDQEKKKIETEMGVNRFFLIVGKPFKGQVDTFEMDKYD
FGTVRTFQQFLDFSGVTFEEGKNDTDSCHQLHWVPYKDPTDVEKIMGGTWKLYPETKAVE
IPEPTKNKDDPTEKLFEKAANPNLQANKPGEGMRLRQDPVDAVPGGAGGSFFLFVFVVAA
LFIAFSNDRVSLSIRRVFRAKGPTNANTSARWFKLPIMAGNKHKNGIICMFPGCEKKMRT
QKFKGHFVKAHLREGEEYTVEHRRQFEVAQAEPLPDSDSASATGSPLAMVGTPKAKADAL
KRVALDSIKKLPEALVAAPVAPPPTFVPVAEPDDLQTNVAVVAPQMVAPPTATPPPRQKR
PAAAMANDMSMAPQVASPTSNALATPVLDESAMFKMLMLMDRRYNELAAKVDELIETQRL
MLSAIMSKDATLEEHVSKKRKEASSTIVYIRSMSEAAVEAFTSVDQTLAAVEEHLKVFDN
KSVEEFLQDLSPVEKAKAQVALAYSINALLYVYLKAQGVSSKDIRQTHVKQELDRVKGFI
KKIKDAEELAKGPTLKLDKEASKRFVNNALSRDQVYTDALEARKKEDDEKNNTQNASSTP
AKKEAATAKRGNDTKAKGSEKNNNKKQRRK

Enzyme Prediction     

No EC number prediction in EPrPAT00000017417-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT60	65	379	2.6e-58	0.996969696969697

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371506	GlcNAc	3.79e-46	65	379	1	350	Glycosyltransferase (GlcNAc). GlcNAc is an enzyme that carries out the first glycosylation step of hydroxylated Skp1, a ubiquitous eukaryotic protein, in the cytoplasm.
397897	Sas10_Utp3	5.14e-09	761	842	1	84	Sas10/Utp3/C1D family. This family contains Utp3 and LCP5 which are components of the U3 ribonucleoprotein complex. It also includes the human C1D protein and Saccharomyces cerevisiae YHR081W (rrp47), an exosome-associated protein required for the 3' processing of stable RNAs, and Sas10 which has been identified as a regulator of chromatin silencing. This family also includes the human protein Neuroguidin an initiation factor 4E (eIF4E) binding protein.
173412	PTZ00121	4.27e-04	830	930	1404	1504	MAEBL; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22573.1|GT60	3.87e-198	23	503	28	496
QVE55543.1|GT60	1.10e-190	19	413	21	414
UIZ25301.1|GT60	8.37e-188	29	413	13	398
UIZ25379.1|GT60	8.01e-150	6	413	10	420
CCA18910.1|GT60	2.58e-35	70	396	91	412

PDB Hits     

EPrPAT00000017417-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ZHS3|C1D_CHICK	1.17e-15	762	870	19	122	Nuclear nucleic acid-binding protein C1D OS=Gallus gallus OX=9031 GN=C1D PE=2 SV=1
sp|O35473|C1D_MOUSE	1.55e-15	759	870	16	122	Nuclear nucleic acid-binding protein C1D OS=Mus musculus OX=10090 GN=C1d PE=1 SV=1
sp|Q7TSU0|C1D_CRIGR	2.11e-15	759	870	16	122	Nuclear nucleic acid-binding protein C1D OS=Cricetulus griseus OX=10029 GN=C1D PE=2 SV=1
sp|Q13901|C1D_HUMAN	9.93e-15	759	870	16	122	Nuclear nucleic acid-binding protein C1D OS=Homo sapiens OX=9606 GN=C1D PE=1 SV=1
sp|Q32PE4|C1D_BOVIN	9.93e-15	759	870	16	122	Nuclear nucleic acid-binding protein C1D OS=Bos taurus OX=9913 GN=C1D PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000206	0.999763	CS pos: 19-20. Pr: 0.9796

TMHMM  Annotations     

Start	End
463	485