CAZyme Information: EPrPAT00000017276-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000017276-p1
• CAZy Family: GH16
• CAZyme Description: UDP-N-acetylglucosamine-peptide N-acetylglucosaminyltransferase 110 kDa subunit.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1378		156012.83	6.7144

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0136:11473-15609(-)

Full Sequence      

MIAPKMASACMRLRSSAALRHCLSRRIGLCLVLLICITVGCAAFSVIVSPENEAAALRAI
ELYDQARQAEKLDNVNEAVELYRRSLDAYEWLPGAYNNLAMAELRATGDRSRALAILKRG
AAVASELHDNKTLGAMYNNMGFIVRQEAPLSVTHCLQAIEYYNQALDAVPDFVDALFNKA
SALRAMKENPQAAELLYRVLQLRPDHHSALLDLGSIFFEWGDVDTAVQYQDAAISVAPSM
ALKLGIMHNKGHFLRASGALEEALRVHEDALAMAPTDPMALTDVVIARRPLCVWEHREEL
LDRMLVAVTKPNLAVLLPYDSTLLPVTNAIRKQLAVALSRAFRQSTTLELLPLRDIPVTA
EARRPLRVGYLSFDFRDHPMGHLTLGLLESHDVERVQVHCYSYGTNDKSEWRHRAERRCH
TFVDGAALSDLELAQRIALDEVDILIDLMAHTTGARLGISALRPSRVIVNYLGFPGTMGA
SFTDFVLVDHFVVPPEYANDSMTEQIVYLPHTYQVNEYELDIGACSAGDDECMRAIRREE
GLPEDAVILCNFNTIDKMEPVSFGVWMNVLRQVPNSILWLLQPSKKHASRIERSLRREAE
ARGIDSSRIVFAPRVSKRRHLARITIADVFLDSFIYNAHSTASDALWANVPLLTLWGDSF
PSRVAGSLLSNLIGVPDLVPTSIKEYENLGVLLASSPELRSRIRAELARHSFTAPLFDTK
RTTADIETAYELMHDIRHRLNHAPRLQRYHVSVGSSQSDFLRSEDRTAVFVRTAVVSGMA
KQESRQYTEAKSIYERILRSQPNEIDARHLLGVTLHQLGNHHQALEVLDEVRRSHPNVAL
FRYNLALVLLALHRVTAAKAELREALQLDPTYHAALFQLTDILLRESAFPDVTDMYDKLG
GPLFLEHSDHSEHVPDDIREQALLQYSFALTKSSRSDDALRILRSMVERHPYYFRATYNL
AAIFIERGYYSMGDEWQVRAAVNEARHAFSTRGQFFTKYKRPHARKVVVFYCHEYGQSWW
DAWGPSSLRTGLGGSEEAVVYLSRELQRLGFWVEVYGDPPLEDITAETSDRESVKWYPHY
AYDPDDREVDVFVAWRYHIALAVGALSRQKFFWVHDVPSEDATHSRLLRETVDGILCVSH
FQASLFPTELQTKIIVTSNALDPAHFVELDRMARHRNHRFVYGSSPGRGLYDLLLVWPRI
RTHIPDATLRVFYGFTPAFLNWGRRNIKDFQTWKQAIDQMLKQPGVDYVGLVDHGTLATE
YASAGFYLYPTTYSETSCVSLMKAMANGAIPITSRFPSSALRETCGEFDLGPRSVLADSS
PIDDHEWLDLWVRSIVDAVKHPNETEDLRTRMIQFARHKYQWANVAAQWRLLFTDGPV

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT41	66	742	1.5e-116	0.6638297872340425

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226428	Spy	4.62e-99	251	733	149	614	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].
404688	Glyco_transf_41	1.61e-74	291	726	1	543	Glycosyl transferase family 41. This family of glycosyltransferases includes O-linked beta-N-acetylglucosamine (O-GlcNAc) transferase, an enzyme which catalyzes the addition of O-GlcNAc to serine and threonine residues. In addition to its function as an O-GlcNAc transferase, human OGT also appears to proteolytically cleave the epigenetic cell-cycle regulator HCF-1.
276809	TPR	2.47e-13	157	235	19	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
223533	TPR	4.51e-13	51	264	87	291	Tetratricopeptide (TPR) repeat [General function prediction only].
276809	TPR	1.23e-12	778	867	8	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG56498.1|GT41	3.38e-112	49	572	30	559
ALF56607.1|GT41	9.88e-97	366	733	17	370
QQO22916.1|GT41	3.10e-95	174	744	87	664
QQN61861.1|GT41	2.08e-94	55	733	14	654
ALF56465.1|GT41	8.45e-94	366	736	24	380

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VSN_A	2.16e-63	171	707	22	533	Structure and topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004],2VSN_B Structure and topological arrangement of an O-GlcNAc transferase homolog: insight into molecular control of intracellular glycosylation [Xanthomonas campestris pv. campestris str. 8004]
2JLB_A	2.16e-63	171	707	22	533	Xanthomonas campestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2JLB_B Xanthomonas campestris putative OGT (XCC0866), complex with UDP- GlcNAc phosphonate analogue [Xanthomonas campestris pv. campestris],2VSY_A Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2VSY_B Xanthomonas campestris putative OGT (XCC0866), apostructure [Xanthomonas campestris pv. campestris str. ATCC 33913],2XGM_A Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGM_B Substrate and product analogues as human O-GlcNAc transferase inhibitors. [Xanthomonas campestris],2XGO_A XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGO_B XcOGT in complex with UDP-S-GlcNAc [Xanthomonas campestris],2XGS_A XcOGT in complex with C-UDP [Xanthomonas campestris],2XGS_B XcOGT in complex with C-UDP [Xanthomonas campestris]
6Q4M_A	5.72e-57	291	730	158	702	Crystal structure of the O-GlcNAc transferase Asn648Tyr mutation [Homo sapiens]
5NPR_A	9.43e-57	291	730	152	696	The human O-GlcNAc transferase in complex with a thiol-linked bisubstrate inhibitor [Homo sapiens]
5NPS_A	9.57e-57	291	730	153	697	The human O-GlcNAc transferase in complex with a bisubstrate inhibitor [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9M8Y0|SEC_ARATH	3.17e-70	291	730	508	948	Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
sp|Q8CGY8|OGT1_MOUSE	3.88e-55	291	730	476	1020	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus OX=10090 GN=Ogt PE=1 SV=2
sp|P81436|OGT1_RABIT	9.04e-55	291	730	476	1020	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2
sp|O15294|OGT1_HUMAN	1.20e-54	291	730	476	1020	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens OX=9606 GN=OGT PE=1 SV=3
sp|Q27HV0|OGT1_PIG	2.79e-54	291	730	476	1020	UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa OX=9823 GN=OGT PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.829125	0.170873

TMHMM  Annotations     

Start	End
27	49