CAZyme Information: EPrPAT00000017042-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000017042-p1
• CAZy Family: GH15
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
527	PaphDAOMBR444_SC0125|CGC1	58350.46	7.0105

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0125:33078-34661(-)

Full Sequence      

MARVLLLVLGVVAAVAQHTGGDSDELPRVAVQSTAAASADPVKPQPTEGVTASLEFHRHE
VERLKALQTDLTRRLIQAQVELSNIDGDITREARRYEESRAELVVQNALPSPRTKRRLTC
MGWKKTSMCRWTGRRNPALDKSCFTPVPGAQAGYCEVRDDDTREYFRVMRSNCSTMPEAT
QLWCQMAPHFANFPAEIKAVAAEALPVKGEGDGIVLTVTAAELPLAKRAVHKLRAVGCNL
PIEIWYVASDASPPQLHSEDNDVRFRPLPRMPFSSQFTFFAKIYAIASSSFARALYVDAS
ATPLRDPTSLFASVEFAANGAVFWPHVFHPMTTESNIHAASLVWELLDIPFVNAFEQDDR
LMLIRRDSNAATALRVLQLFAAHRPNLFEKLQLVSQGKDLFRLAWLALGLPFHVIAQPPA
LGGSMVHGSFCGTHLVQYDTSGELVFSHAQYGTDDAPVPTHVQEFDMGHGQTRLSVIESM
HAYLVQRAHAVGIAQEGTTQKPQECYQHTSSSDRVTTREWKTAQPVM

Enzyme Prediction     

No EC number prediction in EPrPAT00000017042-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	211	439	4.4e-30	0.9962121212121212

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402574	Mannosyl_trans3	3.98e-21	211	439	1	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
133018	GT8_Glycogenin	4.79e-04	216	329	6	129	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28362.1|GT71	2.52e-55	111	483	659	1058
UIZ27901.1|GT71	1.09e-54	114	486	66	455
AIG56191.1|GT71	3.02e-50	110	448	33	395
CCA25306.1|GT71	1.10e-49	115	465	66	462
UIZ24059.1|GT71	1.36e-47	120	465	143	534

PDB Hits     

EPrPAT00000017042-p1 has no PDB hit.

Swiss-Prot Hits     

EPrPAT00000017042-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000323	0.999651	CS pos: 16-17. Pr: 0.9655

TMHMM  Annotations     

There is no transmembrane helices in EPrPAT00000017042-p1.