CAZyme Information: EPrPAT00000017034-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000017034-p1
• CAZy Family: GH131
• CAZyme Description: Alpha mannosyltransferase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1067	PaphDAOMBR444_SC0125|CGC1	119814.74	4.9333

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0125:39284-43074(+)

Full Sequence      

MRVMRWLWTLLLPVAACALDASRDVAEVTVAMDGAFDFAVDESLLELNATADESPDGQTA
TIVIGVKTDVLRGGAARQAIRETWGRSGYGVRVLFIGCRPTWASLGDAERLKAQQAILEE
RSMYQDLLVEELRCQDTPEALVEKTIEFLHFAYTRHPLAAFAMVTDDSVFVRRDRLIQFL
TSDSTPRERFYAGNTPTPAYRDVSPVHRDPQSPYYLSEDDYPMSELPPFLDGAHYIVSRD
IMEFISINRDDLQGFRGLDDVTMALWMLALQVHPVFLDDFAFFGVTCPDGDWTSLAQLTP
DHMRRVHANLVDSLRPCLGFQMAGDWASTVTFRWDLQHDPDASSLRIAVTMTPEGSGNAV
ELFYVPSSAPYEEAFCNALRSVFPRVSPIMLRQLCEKHARSLLPILTRDDGDAPGLRPRL
VIAHHNVARYVESADPAQRIVIGLSRSARYARVVIECLFVEMHPDKSVVVVNEEDLQGSM
PDVMLFSILDEPAKHVLEIPFADAPPVGQYFIDKYAGRSQLMMISGETYPLKDLDPRVIL
LTYDLASNQPKHLYLPVVSTAFGESIRHSPLQLVRPLESIDPHPKTQFCAYLYARCDRPA
REYMYDLLNDAEPVDALGVCQGARRPPLRSRFASRISVFYIDDAVTKYKDYKFVIAFENT
IDAPGYVTEKILTAFLAGAVPVYFGHASSVSRLFNPRAFINCGVFESLRACARHVLAVHS
TPELYEAMRREPPVVDAEAFADAFSWHAEVVEWMQQQQQQERRMSRRLQELMGSAGLRSQ
KGSETEIMKCWVWIWAALTLPLDVCAASLNGTFLVIGIKSSVLRGRVNRQAIRATWAAPE
LTTPLGVHVLFLGGEPDLSVLEHTHRHEEIQLVESEKSTYGDLLTHELGCQDSFFSLVDK
TAAFIKYTADRFPTAAYVMLIDDDAQLQGLRGLDDVTMALWIRAMVNIQPQDMPQIRIMR
LTNCTNDIAVYADLSPQALRSIHNNLVSARSFCDGFDLEAWGKEYQTIHFPVLEAEDISM
TPVGASGGNEGDIRFQWDVQIQPCTGVMEIETTVQVKNERVVATGLR

Enzyme Prediction     

EC	2.4.1.122:14	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT31	76	274	5.3e-34	0.9739583333333334
GT10	571	730	1.7e-32	0.42363112391930835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
250845	Galactosyl_T	3.05e-22	75	278	1	196	Galactosyltransferase. This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.
395683	Glyco_transf_10	2.12e-15	585	725	1	130	Glycosyltransferase family 10 (fucosyltransferase) C-term. This is the C-terminal domain of a family of fucosyltransferases. This enzyme transfers fucose from GDP-Fucose to GlcNAc in an alpha1,3 linkage. This family is known as glycosyltransferase family 10. The C-terminal domain is the likely binding-region for ADP (manuscript in publication).
215596	PLN03133	4.35e-09	159	273	476	585	beta-1,3-galactosyltransferase; Provisional
250845	Galactosyl_T	4.99e-08	829	924	3	90	Galactosyltransferase. This family includes the galactosyltransferases UDP-galactose:2-acetamido-2-deoxy-D-glucose3beta-galactosyltransferase and UDP-Gal:beta-GlcNAc beta 1,3-galactosyltranferase. Specific galactosyltransferases transfer galactose to GlcNAc terminal chains in the synthesis of the lacto-series oligosaccharides types 1 and 2.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QED36502.1|GT10	5.36e-17	585	736	118	264
AWP13074.1|GT31	1.63e-16	76	306	95	316
AAI32529.1|GT31|2.4.1.122	2.87e-16	76	306	93	314
CAM19511.1|GT31|2.4.1.122	2.87e-16	76	306	93	314
BAA94496.1|GT31	2.87e-16	76	306	93	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2NZW_A	7.82e-12	585	740	179	321	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZW_C Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],2NZX_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZX_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP [Helicobacter pylori],2NZY_A Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_B Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori],2NZY_C Crystal Structure of alpha1,3-Fucosyltransferase with GDP-fucose [Helicobacter pylori]
5ZOI_A	1.30e-10	585	740	179	321	Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori],5ZOI_B Crystal Structure of alpha1,3-Fucosyltransferase [Helicobacter pylori]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9MYM7|B3GT1_PONPY	5.11e-17	76	306	93	314	Beta-1,3-galactosyltransferase 1 OS=Pongo pygmaeus OX=9600 GN=B3GALT1 PE=3 SV=1
sp|Q7JK24|B3GT1_GORGO	5.11e-17	76	306	93	314	Beta-1,3-galactosyltransferase 1 OS=Gorilla gorilla gorilla OX=9595 GN=B3GALT1 PE=3 SV=1
sp|Q7JK25|B3GT1_PANPA	5.11e-17	76	306	93	314	Beta-1,3-galactosyltransferase 1 OS=Pan paniscus OX=9597 GN=B3GALT1 PE=3 SV=1
sp|Q7JK26|B3GT1_PANTR	5.11e-17	76	306	93	314	Beta-1,3-galactosyltransferase 1 OS=Pan troglodytes OX=9598 GN=B3GALT1 PE=3 SV=1
sp|Q9Y5Z6|B3GT1_HUMAN	5.11e-17	76	306	93	314	Beta-1,3-galactosyltransferase 1 OS=Homo sapiens OX=9606 GN=B3GALT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001183	0.998803	CS pos: 18-19. Pr: 0.7079

TMHMM  Annotations     

There is no transmembrane helices in EPrPAT00000017034-p1.