CAZyme Information: EPrPAT00000016604-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000016604-p1
• CAZy Family: CE5
• CAZyme Description: Regulator of chromosome condensation (RCC1).

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1361		152959.96	6.0399

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0105:40881-45653(-)

Full Sequence      

MEKSRKVSVLLSKMTPEELFKRYDTDGSGNISLAEFLAMLPDLGIRMSEAKAIRIFKKCD
TDGTGEIDLTEFKTAMFAVDPVSGNTLGFTPSAFLTPRDAFELFDEDGTGKIDELEFADV
LEYFGMNVSDAKQEAMFKKYDKDKSGYIDYKEFRSMWIRLSNVREELEKRGVEVPKYATP
WKLQHMLEEILDEEEAREAQVLAEAQMFLEKQREKQRRQDLGRKALIRAQDELAAALDAA
GQVYVLGTGKYGQFNGEAVVRDETRFPGFKEVSEIWSFRVDPTVVEDKVTLLQDEPNNKS
PEQKSPEVAIVEKIENQEIPKRKGKYVRRRPENTRWGFQSPPKLNVQTMQGLKHQIKCIH
ENSGNSNDQDTDKKKETSPSEANGDEPREARLARLFYEDREFVRSLRFQSTVIMHNTGSL
WGRGVLCGALSDDVAFAVTHGGSVFVWGGKDRQKESTLMQRVALLNDEEENATTESIGQN
EEPAAITKQKTNEHPERITPRSSIVKMATASQIDANTQDATEQESREEYVLEADIKQSDE
DDMYTKMKSVVMYYNEWEPPPSNATKMLFMEQVLLPRLKYEKLQASARYRGLKSEVTRIT
KLGLILLLAECFALEREVKSDAGHTNLKAQEEMITGLEEAKDKQSKLKLETWSELRGLRE
ERQAAAEIEDRKKEIERLNRLLKLQDTTFEAVVERRHVQMEDLTPEYTTRGVNARIEVSG
ITTRSVYTWGIGSDGRLGLSPPSPQQPMQARRLLDSNHPQRVDAFTDVSIRQVSCGFSHS
AAVGSDGQLFTWGSAIDGKLGVGVVEDHYEQFTTQPLTVKFPGTRKIRFVSCGASHTGAV
TTQGELFMWGSANGGRLGLGAAVQDTVVVPTLVTELSSRKIRVWQVSCGTTHSALCTETT
SESRGGSKTLLGGHVYTCGGPTALGKHSPMWIRVESLVQASVAIKQLSCGVAHTTAVSAY
GELYTWGRNAKGCTGHSIDRLFIPSPELVRSLHVEPYNLAFGKRCKQINIYNEQGPEMAV
NSDIDGRLERCSHTHLEDKPWWEVDLGQPAVIERIRVWNRSDEPSNPSKRRDEYSGRLFP
FWILVSEFPFRGDLQGKEGLRAAKNQSAAFIQIEENRRLTEWLLPTAQTIGQYVRIQLEG
RNFLHLAEVEVFGVYSAFNYVGRVGEAHAGNDATLVIVPPSPQQTALDDYYLRAVQADAD
NATILRQFEAYESSYRRFGRDDGDVLGKKCRLCRIFRECEVCEFVNKVNAARLRDEATGE
MPKRVVGDRLGLAALTCSIDQDLVKLAVDDDGLEEEAQQRERQRADEVAVRLAVEAKHKA
EEAAAAAARKLAARALLKKVLPGPMRKITAAFPLRKAMDKV

Enzyme Prediction     

No EC number prediction in EPrPAT00000016604-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM47	1011	1149	2.9e-19	0.9453125

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227511	ATS1	1.32e-22	721	991	192	441	Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell cycle control, cell division, chromosome partitioning, Cytoskeleton].
227511	ATS1	1.71e-20	714	979	54	321	Alpha-tubulin suppressor and related RCC1 domain-containing proteins [Cell cycle control, cell division, chromosome partitioning, Cytoskeleton].
227455	FRQ1	1.76e-20	1	159	1	156	Ca2+-binding protein, EF-hand superfamily [Signal transduction mechanisms].
238008	EFh	4.33e-16	98	157	3	62	EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands. Ca2+ binding induces a conformational change in the EF-hand motif, leading to the activation or inactivation of target proteins. EF-hands tend to occur in pairs or higher copy numbers.
320060	EFh_PEF_ALG-2_like	1.36e-15	20	164	6	135	EF-hand, calcium binding motif, found in homologs of mammalian apoptosis-linked gene 2 protein (ALG-2). The family includes some homologs of mammalian apoptosis-linked gene 2 protein (ALG-2) mainly found in lower eukaryotes, such as a parasitic protist Leishmarua major and a cellular slime mold Dictyostelium discoideum. These homologs contains five EF-hand motifs. Due to the presence of unfavorable residues at the Ca2+-coordinating positions, their non-canonical EF4 and EF5 hands may not bind Ca2+. Two Dictyostelium PEF proteins are the prototypes of this family. They may bind to cytoskeletal proteins and/or signal-transducing proteins localized to detergent-resistant membranes named lipid rafts, and occur as monomers or weak homo- or heterodimers like ALG-2. They can serve as a mediator for Ca2+ signaling-related Dictyostehum programmed cell death (PCD).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOX79078.1|CBM47	1.10e-17	998	1153	131	272
ACD95713.1|CBM47	1.04e-16	998	1153	131	272
QTD39109.1|CBM47	6.29e-16	998	1155	1352	1495
AZM48749.1|CBM47|GH29	2.80e-15	994	1151	614	761
AXE77546.1|CBM47|GH29	1.36e-13	994	1153	678	827

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4DNW_A	3.26e-23	726	975	78	298	Crystal structure of UVB-resistance protein UVR8 [Arabidopsis thaliana],4DNW_B Crystal structure of UVB-resistance protein UVR8 [Arabidopsis thaliana]
4NAA_A	3.41e-23	726	975	77	297	Crystal structure of UVB photoreceptor UVR8 from Arabidopsis thaliana and UV-induced structural changes at 120K [Arabidopsis thaliana],4NAA_B Crystal structure of UVB photoreceptor UVR8 from Arabidopsis thaliana and UV-induced structural changes at 120K [Arabidopsis thaliana],4NAA_C Crystal structure of UVB photoreceptor UVR8 from Arabidopsis thaliana and UV-induced structural changes at 120K [Arabidopsis thaliana],4NAA_D Crystal structure of UVB photoreceptor UVR8 from Arabidopsis thaliana and UV-induced structural changes at 120K [Arabidopsis thaliana],4NBM_A Crystal structure of UVB photoreceptor UVR8 and light-induced structural changes at 180K [Arabidopsis thaliana],4NBM_B Crystal structure of UVB photoreceptor UVR8 and light-induced structural changes at 180K [Arabidopsis thaliana],4NBM_C Crystal structure of UVB photoreceptor UVR8 and light-induced structural changes at 180K [Arabidopsis thaliana],4NBM_D Crystal structure of UVB photoreceptor UVR8 and light-induced structural changes at 180K [Arabidopsis thaliana],6DD7_A Crystal structure of plant UVB photoreceptor UVR8 from in situ serial Laue diffraction [Arabidopsis thaliana],6DD7_B Crystal structure of plant UVB photoreceptor UVR8 from in situ serial Laue diffraction [Arabidopsis thaliana],6DD7_C Crystal structure of plant UVB photoreceptor UVR8 from in situ serial Laue diffraction [Arabidopsis thaliana],6DD7_D Crystal structure of plant UVB photoreceptor UVR8 from in situ serial Laue diffraction [Arabidopsis thaliana]
6XZM_A	4.32e-23	726	975	81	301	Chain A, Ultraviolet-B receptor UVR8 [Arabidopsis thaliana],6XZM_B Chain B, Ultraviolet-B receptor UVR8 [Arabidopsis thaliana]
4D9S_A	5.10e-23	726	975	90	310	Crystal structure of Arabidopsis thaliana UVR8 (UV Resistance locus 8) [Arabidopsis thaliana],4D9S_B Crystal structure of Arabidopsis thaliana UVR8 (UV Resistance locus 8) [Arabidopsis thaliana]
4DNU_A	5.72e-23	726	975	80	300	Crystal structure of the W285A mutant of UVB-resistance protein UVR8 [Arabidopsis thaliana]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FN03|UVR8_ARATH	3.96e-22	726	975	89	309	Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana OX=3702 GN=UVR8 PE=1 SV=1
sp|Q9VR91|HERC2_DROME	6.35e-21	726	980	3040	3269	Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster OX=7227 GN=HERC2 PE=1 SV=3
sp|F2Z461|HERC6_MOUSE	5.84e-20	726	972	43	265	E3 ISG15--protein ligase Herc6 OS=Mus musculus OX=10090 GN=Herc6 PE=2 SV=1
sp|Q4U2R1|HERC2_MOUSE	3.61e-19	726	1055	3014	3339	E3 ubiquitin-protein ligase HERC2 OS=Mus musculus OX=10090 GN=Herc2 PE=1 SV=3
sp|O95714|HERC2_HUMAN	6.19e-19	726	1055	3013	3338	E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000078	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EPrPAT00000016604-p1.