CAZyme Information: EPrPAT00000016346-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000016346-p1
• CAZy Family: CE5
• CAZyme Description: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
334		36372.46	5.7153

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0094:3729-4733(-)

Full Sequence      

MARWHRTLRRPVEFAGVGLHSGRPVRIRVSPAPLQAPPQDATTRVNGITFRLPLAPERPP
IAVSVDAIDPSKSMLCTQLYAADRSWGVSTVEHLMAALTAARITRVSVDILESNSDGIFE
MPILDGSALQFVQGVHEAGVEEVENGETLSYVRVTRPVEVLMKDKAAWLLPVPPAIPGTM
APTLHASVQVNFPHKGLGSSFFQFSLSSDPDANLLAFKERVAPARTFTFEDEIAWMQANN
LALGGSLSNAIVFKSNQDESTSPHTSTPEVLNPDGLLFPDEWVRHKMLDCIGDLGLVGLP
LHGHFFSTSPGHALTHTLICELFSDSANYEIITQ

Enzyme Prediction     

No EC number prediction in EPrPAT00000016346-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE11	6	323	1.2e-65	0.988929889298893

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397424	LpxC	1.88e-100	6	324	2	271	UDP-3-O-acyl N-acetylglycosamine deacetylase. The enzymes in this family catalyze the second step in the biosynthetic pathway for lipid A.
237294	lpxC	1.36e-95	6	333	5	283	UDP-3-O-acyl-N-acetylglucosamine deacetylase.
223845	LpxC	5.03e-78	6	333	5	286	UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell wall/membrane/envelope biogenesis].
273014	lpxC	2.61e-59	6	333	4	282	UDP-3-0-acyl N-acetylglucosamine deacetylase. UDP-3-O-(R-3-hydroxymyristoyl)-GlcNAc deacetylase from E. coli , LpxC, was previously designated EnvA. This enzyme is involved in lipid-A precursor biosynthesis. It is essential for cell viability. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
237296	PRK13188	5.15e-48	6	315	6	291	bifunctional UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase/(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHG08717.1|CE11	2.51e-55	6	334	4	286
ATR78087.1|CE11	2.51e-55	6	334	4	286
AME01800.1|CE11	9.90e-55	6	334	4	286
ATW85136.1|CE11	9.90e-55	6	334	4	286
ATQ82635.1|CE11	9.90e-55	6	334	4	286

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MO5_A	2.35e-40	6	333	10	290	Co-Crystal structure of P. aeruginosa LpxC-50228 complex [Pseudomonas aeruginosa PAO1],6MOD_A Co-Crystal structure of P. aeruginosa LpxC-50432 complex [Pseudomonas aeruginosa]
5U39_A	2.65e-40	6	333	7	287	Pseudomonas aeruginosa LpxC in complex with CHIR-090 [Pseudomonas aeruginosa PAO1]
4J3D_A	2.78e-40	6	333	5	285	Pseudomonas aeruginosa LpxC in complex with a hydroxamate inhibitor [Pseudomonas aeruginosa PAO1],4J3D_B Pseudomonas aeruginosa LpxC in complex with a hydroxamate inhibitor [Pseudomonas aeruginosa PAO1]
2VES_A	2.92e-40	6	333	5	285	Crystal Structure of LpxC from Pseudomonas aeruginosa complexed with the potent BB-78485 inhibitor [Pseudomonas aeruginosa PAO1],2VES_B Crystal Structure of LpxC from Pseudomonas aeruginosa complexed with the potent BB-78485 inhibitor [Pseudomonas aeruginosa PAO1],2VES_C Crystal Structure of LpxC from Pseudomonas aeruginosa complexed with the potent BB-78485 inhibitor [Pseudomonas aeruginosa PAO1],3P3E_A Crystal Structure of the PSEUDOMONAS AERUGINOSA LpxC/LPC-009 complex [Pseudomonas aeruginosa],3U1Y_A Potent Inhibitors of LpxC for the Treatment of Gram-Negative Infections [Pseudomonas aeruginosa],3U1Y_B Potent Inhibitors of LpxC for the Treatment of Gram-Negative Infections [Pseudomonas aeruginosa],3UHM_A UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase in complex with inhibitor [Pseudomonas aeruginosa],4LCF_A Crystal structure of the Pseudomonas aeruginosa LPXC/LPC-014 complex [Pseudomonas aeruginosa PAO1],4LCG_A Crystal structure of the Pseudomonas aeruginosa LPXC/LPC-050 complex [Pseudomonas aeruginosa PAO1],4LCH_A Crystal structure of the Pseudomonas aeruginosa LPXC/LPC-051 complex [Pseudomonas aeruginosa PAO1],4OKG_A LpxC from P.aeruginosa with the inhibitor 6-(benzimidazol-1-yl)-5-[4-[2-[6-[(4-methylpiperazin-1-yl)methyl]-3-pyridyl]ethynyl]phenyl]pyridine-3-carbohydroxamic acid [Pseudomonas aeruginosa PAO1],4OKG_B LpxC from P.aeruginosa with the inhibitor 6-(benzimidazol-1-yl)-5-[4-[2-[6-[(4-methylpiperazin-1-yl)methyl]-3-pyridyl]ethynyl]phenyl]pyridine-3-carbohydroxamic acid [Pseudomonas aeruginosa PAO1],5DRQ_A Crystal structure of the Pseudomonas aeruginosa LpxC/LPC-040 complex [Pseudomonas aeruginosa PAO1],5DRR_A Crystal structure of the Pseudomonas aeruginosa LpxC/LPC-058 complex [Pseudomonas aeruginosa PAO1],6I46_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I47_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I48_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I49_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I49_BBB Chain BBB, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],6I4A_AAA Chain AAA, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa LESB58],7CI4_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI4_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI5_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI5_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI5_C Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI5_D Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI6_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI6_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI7_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI8_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI8_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CI9_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIA_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIB_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIC_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIC_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CID_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIE_A Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7CIE_B Crystal structure of P.aeruginosa LpxC in complex with inhibitor [Pseudomonas aeruginosa PAO1],7DEL_A Chain A, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa PAO1],7DEM_A Chain A, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa PAO1],7DEN_A Chain A, UDP-3-O-acyl-N-acetylglucosamine deacetylase [Pseudomonas aeruginosa PAO1]
5U3B_A	2.92e-40	6	333	5	285	Pseudomonas aeruginosa LpxC in complex with NVS-LPXC-01 [Pseudomonas aeruginosa PAO1],5U3B_B Pseudomonas aeruginosa LpxC in complex with NVS-LPXC-01 [Pseudomonas aeruginosa PAO1],6MAE_A CHAIN A. UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase PA-LPXC Complexed with (R)-3-((S)-3-(4-(cyclopropylethynyl)phenyl)-2-oxooxazolidin-5-yl)-N-hydroxy-2-methyl-2-(methylsulfonyl)propenamide [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2IPK1|LPXC_ANADE	3.18e-46	1	332	1	282	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxC PE=3 SV=1
sp|B5EFL8|LPXC_CITBB	2.44e-44	4	332	3	282	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Citrifermentans bemidjiense (strain ATCC BAA-1014 / DSM 16622 / JCM 12645 / Bem) OX=404380 GN=lpxC PE=3 SV=1
sp|C6E4T9|LPXC_GEOSM	6.77e-44	4	332	3	282	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Geobacter sp. (strain M21) OX=443144 GN=lpxC PE=3 SV=1
sp|A7H914|LPXC_ANADF	9.95e-43	1	332	1	282	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Anaeromyxobacter sp. (strain Fw109-5) OX=404589 GN=lpxC PE=3 SV=1
sp|Q3SMG6|LPXC_THIDA	1.40e-42	6	333	5	285	UDP-3-O-acyl-N-acetylglucosamine deacetylase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=lpxC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999979	0.000077

TMHMM  Annotations     

There is no transmembrane helices in EPrPAT00000016346-p1.