CAZyme Information: EPrPAT00000016204-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000016204-p1
• CAZy Family: CE1
• CAZyme Description: Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit STT3A.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
886	PaphDAOMBR444_SC0088|CGC1	97971.76	7.7190

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0088:21021-23743(-)

Full Sequence      

MAAKSKAKKRDDGPEPAPQAPREAPVASDASVPSAKNKRMVFGVDLDSPVDVEDEANVLA
PVAKYAILGMICLMSFAIRLFAVVRYESVIHEFDPYFNYRTTKYLATEGFLEFLDWFDDR
AWYPLGRIIGGTIYPGLMYTAAMVYWVLNLFNISINVRNTCVFLAPVFAANTAIASYLLT
KEVTKRSSAGLLAAAFAGIVPSYISRSVGGSYDNEGVAIFALIFVFYLWIKAVHTGSMFW
SACCALAYFYMVAAWGGYVFIINMIPIYVLVMIFAGRYSPRLYIAYSTFYTLGSLMAMQV
PFVGFNVVKQAECAGSHGVFVLLQVYCFVNWVRNFISAESFRRLVIFGAGLVVAAVASIL
VVLQLMGKVQWTGRSLTLLDPTYASKYIPIIASVSEHQPTTWTSYFFDLHVLVPFAPVGL
YFLFSNLTDGGIFVILYGTVAWYFAGVMVRLMLTLAPIACILGAIGISSTLRKFMGILRR
PSSFVLQKNSAQEVPVPIALSVIGGLLLLLLSYTFHATFVSSMAYSSPSIVIEAGRTHSG
ERINFDDYREAYFWLRQNTDANAKIMAWWDYGYQMSAMANRTVIVDNNTWNNTHIATVGR
ALASTEEDAYPIMQSLDVDYVLVIFGGLTGYSSDDINKFLWPVRIGSGVYPNDMPSERDF
YSASGNFDVGVGGSKVLHNCLAYKLCYYRFGEVMTDYQRPPGFDRARNTEVGVKQIKLTH
LEEAFTSEHWIVRIYKVKKQPNVEPTTALKKARLQEAAAGGNDISNEKTHFVGCVTGEDM
LGNDRVYSGGASGANYNLALHHAKSKNKKYFAISRVGGEGHAFAFNKLPINAADFDGNDA
GCKRPCLDSREHFCGCADAGCADSGVGPGEGQEHSRRWAIYERDNA

Enzyme Prediction     

EC	2.4.99.18:21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT66	65	695	5.8e-170	0.8542568542568543

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396873	STT3	6.01e-110	64	526	3	478	Oligosaccharyl transferase STT3 subunit. This family consists of the oligosaccharyl transferase STT3 subunit and related proteins. The STT3 subunit is part of the oligosaccharyl transferase (OTase) complex of proteins and is required for its activity. In eukaryotes, OTase transfers a lipid-linked core-oligosaccharide to selected asparagine residues in the ER. In the archaea STT3 occurs alone, rather than in an OTase complex, and is required for N-glycosylation of asparagines.
224206	Stt3	1.61e-64	57	739	13	731	Asparagine N-glycosylation enzyme, membrane subunit Stt3 [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ23018.1|GT66	0.0	1	883	1	882
CCA15036.1|GT66	0.0	53	881	51	877
CCA23157.1|GT66	0.0	53	881	51	877
AFJ69334.1|GT66	0.0	47	882	47	890
ACI33169.1|GT66	1.80e-282	64	742	19	699

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FTG_5	1.43e-282	64	742	19	699	Subtomogram average of OST-containing ribosome-translocon complexes from canine rough microsomal membranes [Canis lupus familiaris],6FTI_5 Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Programmed 80S Ribosome [Canis lupus familiaris]
6FTJ_5	2.09e-282	64	738	19	695	Cryo-EM Structure of the Mammalian Oligosaccharyltransferase Bound to Sec61 and the Non-programmed 80S Ribosome [Canis lupus familiaris]
6S7O_A	4.07e-282	64	742	19	699	Cryo-EM structure of human oligosaccharyltransferase complex OST-A [Homo sapiens]
6S7T_A	2.74e-267	64	744	73	779	Cryo-EM structure of human oligosaccharyltransferase complex OST-B [Homo sapiens]
6C26_A	4.70e-215	57	739	10	684	The Cryo-EM structure of a eukaryotic oligosaccharyl transferase complex [Saccharomyces cerevisiae S288C],6EZN_F Cryo-EM structure of the yeast oligosaccharyltransferase (OST) complex [Saccharomyces cerevisiae S288C],7OCI_F Chain F, Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3 [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|F1PJP5|STT3A_CANLF	3.67e-282	64	742	19	699	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Canis lupus familiaris OX=9615 GN=STT3A PE=1 SV=3
sp|P46978|STT3A_MOUSE	3.67e-282	64	742	19	699	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Mus musculus OX=10090 GN=Stt3a PE=1 SV=1
sp|P46977|STT3A_HUMAN	2.09e-281	64	742	19	699	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Homo sapiens OX=9606 GN=STT3A PE=1 SV=2
sp|Q5RCE2|STT3A_PONAB	2.09e-281	64	742	19	699	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Pongo abelii OX=9601 GN=STT3A PE=2 SV=1
sp|Q2KJI2|STT3A_BOVIN	2.40e-280	64	742	19	699	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A OS=Bos taurus OX=9913 GN=STT3A PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000052	0.000001

TMHMM  Annotations     

Start	End
65	84
126	148
161	180
190	209
216	238
253	275
282	304
314	332
344	366
402	424
431	448
452	471
498	520