CAZyme Information: EPrPAT00000015994-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000015994-p1
• CAZy Family: AA7
• CAZyme Description: Beta-glucan synthesis-associated protein.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
754	PaphDAOMBR444_SC0081|CGC2	81930.91	5.6780

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0081:45598-47862(+)

Full Sequence      

MRSLVATSLALVIASSRGAEFTTKSGLLPWVDPATPEDRQSYISSRGERWQLVMSDEFNT
PKRSFEPGADHMWTSINKPDGVNSALEIYSHNMTSTMCDDDGTCYFYIKAMEDPTTLRLW
NDYISPPGYEKVTFYYRAGMVQSWNKFCFQGGMVEVRAQLPGAVSKASGNPDAAKGPTTR
TTKSAIIYYPTWPGIWMMGNLGRAIFSASTNRMWPFSYNECNKAVFDPSNQRISACDGNP
GHGMNPYQGRGAPEIDILEGGGTDISSSIQVGPGMPDEYRTLPAAGEGGGCVYTGTCTTP
GANQPDVPTALYKSKRGHKSWYQGLRYASNNYCAPDASEQQSYATVKAAMDKGVTVNSCT
LTTCPGSKDANADLGLIDGVGPDHWGVNTNGTCYPLMNGYTGAFLCSPGHTDPHCTDEDT
PINDNVKQFAYQMDAISSNWPIHVGAYTDYVAYQLEWVTGSEGYVRWMLDGSPIFEIPAT
SIENPPQNSAKSNPKKLMIEEPMYLIMNVALSSTWGTKPPNPKKACRGDGSDPVANRICD
AFPMYMKIDYIRLYQDRSEKSKMAVGCDPATHPTKKWIADHIDEYQDYDNLAIDVRGKAF
CSSDDDCTVGNSTVGKIATGSCVKGRCSCKATSWGGPRCTSTIGDIQATTSDGKMAGMFD
GSYGPPWSAALGVSGFSLIVTVFAVMYSIRVTQQNEADFKKNTHMIPKSAMSITSAAEIG
YNPPKNTQASPAMMTVVEGGQNSAQKTNYATNFV

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	56	279	5e-62	0.598159509202454

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	1.22e-57	31	588	98	479	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	3.92e-48	52	555	1	295	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185693	GH16_laminarinase_like	1.63e-12	435	554	145	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
225182	BglS	9.20e-07	31	221	30	156	Beta-glucanase, GH16 family [Carbohydrate transport and metabolism].
185683	Glyco_hydrolase_16	0.002	445	554	139	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28151.1|GH16	0.0	1	698	8	712
UIZ28149.1|GH16	5.31e-317	18	701	26	714
UIZ28152.1|GH16	4.18e-308	9	754	3	739
UIZ27810.1|GH16	5.69e-306	15	726	59	776
UIZ27996.1|GH16	2.68e-300	13	719	22	714

PDB Hits     

EPrPAT00000015994-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33336|SKN1_YEAST	4.70e-35	31	585	359	739	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1
sp|P32486|KRE6_YEAST	2.79e-34	31	586	307	688	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|P87024|SKN1_CANAX	1.66e-32	31	600	336	729	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1
sp|P87023|KRE6_CANAX	2.56e-28	31	600	332	732	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1
sp|O13941|YEPB_SCHPO	5.09e-28	31	581	219	599	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000315	0.999641	CS pos: 18-19. Pr: 0.9681

TMHMM  Annotations     

Start	End
667	689