CAZyme Information: EPrPAT00000014956-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000014956-p1
• CAZy Family: AA17
• CAZyme Description: Glycoside hydrolase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
649		72906.49	5.7857

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0043:1262-3608(+)

Full Sequence      

MRVFAPVAATLLALTSMGVAAYDSLPNGTKLYGLNYDRRQGPDWDPKQCKDYNTVLEDLR
AVQNVADRVRVYSLGSDSCDSVDVLNAAKSIGLKVALGMWPGPSGWEAEKNRLIRLLNAG
KIDANVVALHVGSEAVYRKEYSAEVAVDYLNQVKQLLKQYNVNLQVTIADVVDSYYQNPI
MLQNVDYVSINQFSFWERVDVADGMSMMLDRIRSIRAQAAAQGKGIIISETGWASGGSDP
GASAATPENQKYFFEAFYRQMKAHDIPYYWFAAQDNLWSLQIKDHSTVEAYFGMMSKDRV
FKDNFRNVALSDAKVTTFKSMSGRFLGESYNPDAPHEVTGIATWEPSNDMLVQLRYQWFY
DEATGHIRSTNSDRCLDAYQAWDGGIVHTYKCIDNEPNQNTTRRPRLSVTPLTVTRAGDD
VVFGFGASGVAGSEWTFDPNTHLIQLANSNLCLDAYEGWDGGDVHMWTCNANEANQMWDL
DSSTGQFRHRTHAGFCLDGDLNGNKIQLWWCMNSDNQMWRVVSSSAKAVRITNADNSVVE
FVTQDQQLGKNKENKNEQAWFWNAYKGTLVSKWNGECLDAYEAWQNGRVHTWGCIDSEKN
QKWKYENGLVKHASHTGFCLAYANAANRQLVLKSCSSTDATQKFTLSAF

Enzyme Prediction     

EC	-	-	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH17	53	299	2.1e-22	0.9228295819935691
CBM13	431	533	1.2e-17	0.574468085106383

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227625	Scw11	3.27e-38	41	299	51	305	Exo-beta-1,3-glucanase, GH17 family [Carbohydrate transport and metabolism].
395527	Ricin_B_lectin	1.27e-21	363	519	1	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	1.96e-19	365	519	1	122	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.
395527	Ricin_B_lectin	2.23e-15	357	478	38	126	Ricin-type beta-trefoil lectin domain.
238092	RICIN	3.31e-13	441	604	1	123	Ricin-type beta-trefoil; Carbohydrate-binding domain formed from presumed gene triplication. The domain is found in a variety of molecules serving diverse functions such as enzymatic activity, inhibitory toxicity and signal transduction. Highly specific ligand binding occurs on exposed surfaces of the compact domain sturcture.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBC18032.1|CBM13|GH17	7.41e-104	1	509	1	424
QBC18038.1|CBM13|GH17	7.41e-104	1	509	1	424
QBC18040.1|CBM13|GH17	7.41e-104	1	509	1	424
QBC18039.1|CBM13|GH17	7.41e-104	1	509	1	424
QBC18034.1|CBM13|GH17	7.41e-104	1	509	1	424

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WTP_A	2.09e-25	32	299	38	286	Crystal structure of glycoside hydrolase family 17 beta-1,3-glucanosyltransferase from Rhizomucor miehei [Rhizomucor miehei CAU432]
4WTR_A	1.29e-24	32	299	38	286	Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaribiose [Rhizomucor miehei CAU432],4WTS_A Active-site mutant of Rhizomucor miehei beta-1,3-glucanosyltransferase in complex with laminaritriose [Rhizomucor miehei CAU432]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B2W4|BGL2_ARTBC	2.91e-16	48	304	36	298	Glucan 1,3-beta-glucosidase ARB_02797 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02797 PE=1 SV=1
sp|O13990|BGL2_SCHPO	6.64e-15	27	304	39	315	Glucan 1,3-beta-glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bgl2 PE=2 SV=4
sp|A1DEV5|BTGC_NEOFI	5.44e-10	53	306	407	678	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=btgC PE=3 SV=1
sp|B0Y429|BTGC_ASPFC	7.17e-10	53	306	407	678	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=btgC PE=3 SV=1
sp|Q4WUK5|BTGC_ASPFU	7.17e-10	53	306	407	678	Probable glucan endo-1,3-beta-glucosidase btgC OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=btgC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000296	0.999681	CS pos: 21-22. Pr: 0.9741

TMHMM  Annotations     

There is no transmembrane helices in EPrPAT00000014956-p1.