CAZyme Information: EPrPAT00000014891-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000014891-p1
• CAZy Family: AA17
• CAZyme Description: Xaa-Pro aminopeptidase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1130		124748.58	6.5394

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0041:47972-52243(+)

Full Sequence      

MPLRRKRDIPRPDGASASTSTTSSSRSARGSSVIARTRRENGTDSDVPASLRESGDSLSG
LKMRPASWPSRLAHFHDGLYRGSGSTNASARDKIRYVGRMVHHGTTTHRPTKINSVQFDW
PACMIEVRVTRTTTVAIRMKGDGNYFNVFVNGAFRCILRASHNATCCDVATDLDPNRENT
VTITKRTEPQTRGALSTFKVCTFYGFIVDEGGEALPCKPNALRRIEFIGDSDTCAFGNEG
LQTHSRRIFGMKGRMENVYNGYACIMARMFDADAHVLAWSGKGVHSNAADWGPNMLSIWK
NALASRQEGSEWDMSSWTPDIVVINLGINDLSPPASSETDIVAAYALLLAEVRSYRPDAD
IFCVVCDESCISSEDNALERSRLSLQLQEIIKVAISKVSKYDSKLHYTLLKIDGGLAKED
YAAFKHYAVSGHLKIAMALAEEIMLRTNWTIHHEPVTMPYPQEKREILVPEEEAKGSCLR
GVACQSATCGLEDKTPKRRTMADKLRELRALFNRTNVRLLPLRNQLAKDGTAAPVEPAEG
KTLQAFLVDTADAHQSEYVSDANKRRAFLSGFTGSNGTALVTPDKALLWTDGRYFLQAEQ
ELSDEWTLMKSEEPGVPTIEKWAAENLGGEGVFAIDPFLTSVSAARNLATALKDSSVELM
ALHETDNLVDLVWKDRPATGKSKVQFLSDKYTGRSVADKLQDVRNAVKEKGADAIVLTAL
DDIAWLFNIRGNDVEFNPVVVSYALITADSAVLFLAAENQDEVEKHLASSNVVCKPYDSI
LSELSSFAAANANMKVLVDPVQCNVAVFLAIPASMRKEETSVVMAQKAIKSDVEIEGMRQ
AHIRDGAALVKFFAWLESELQSGKTLDEVQAADKEQAFREEMEGFVSLSFDTISSIGPNG
AIIHYKPKRGACATVTSKEIYLNDSGAQYLDGTTDVTRTLHFGEPTDYEKDCFTAVLRGH
IALATAVFPNKIEGVKLDALTRAPLWRAGLDYRHGTGHGVGAFLNVHEKGVLLSFRLNPN
GLLIQDGMILSNEPGYYEDGNFGIRIESLLVVKKATHIKSPLQKDFCEFETITMAPIQTK
LINTTLLTQDEVNWLNAYHKTVHDKLKPLLQNSPQAYEYLVRETRPLELK

Enzyme Prediction     

No EC number prediction in EPrPAT00000014891-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	224	443	4.1e-52	0.9952153110047847

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238518	APP	6.82e-122	837	1057	1	219	X-Prolyl Aminopeptidase 2. E.C. 3.4.11.9. Also known as X-Pro aminopeptidase, proline aminopeptidase, aminopeptidase P, and aminoacylproline aminopeptidase. Catalyses release of any N-terminal amino acid, including proline, that is linked with proline, even from a dipeptide or tripeptide.
223085	PepP	7.52e-63	699	1054	13	367	Xaa-Pro aminopeptidase [Amino acid transport and metabolism].
406573	Creatinase_N_2	6.62e-62	675	834	1	159	Creatinase/Prolidase N-terminal domain.
395442	Peptidase_M24	2.99e-51	837	1054	1	206	Metallopeptidase family M24. This family contains metallopeptidases. It also contains non-peptidase homologs such as the N terminal domain of Spt16 which is a histone H3-H4 binding module.
238525	APP-like	2.12e-31	835	1054	1	205	Similar to Prolidase and Aminopeptidase P. The members of this subfamily presumably catalyse hydrolysis of Xaa-Pro dipeptides and/or release of any N-terminal amino acid, including proline, that is linked with proline.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26481.1|CE2	2.95e-180	72	478	82	519
CCA14218.1|CE2	6.02e-111	86	480	63	467
BBE16554.1|CE2	1.83e-32	94	395	31	319
ADO75380.1|CE2	2.15e-32	94	449	46	368
AEY66733.1|CE2	1.25e-31	117	449	127	436

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CTZ_A	8.09e-157	543	1127	27	619	Structure of human cytosolic X-prolyl aminopeptidase [Homo sapiens]
4S2R_P	7.73e-134	497	1127	22	639	Crystal structure of X-prolyl aminopeptidase from Caenorhabditis elegans: a cytosolic enzyme with a di-nuclear active site [Caenorhabditis elegans],4S2R_Q Crystal structure of X-prolyl aminopeptidase from Caenorhabditis elegans: a cytosolic enzyme with a di-nuclear active site [Caenorhabditis elegans],4S2T_P Crystal structure of X-prolyl aminopeptidase from Caenorhabditis elegans: a cytosolic enzyme with a di-nuclear active site [Caenorhabditis elegans],4S2T_Q Crystal structure of X-prolyl aminopeptidase from Caenorhabditis elegans: a cytosolic enzyme with a di-nuclear active site [Caenorhabditis elegans]
5JQK_A	3.13e-90	543	1129	29	655	The Xray Crystal Structure of P. falciparum Aminopeptidase P [Plasmodium falciparum 3D7],5JQK_B The Xray Crystal Structure of P. falciparum Aminopeptidase P [Plasmodium falciparum 3D7],5JR6_A The Xray Crystal Structure of P. falciparum Aminopeptidase P in Complex With Apstatin [Plasmodium falciparum 3D7],5JR6_B The Xray Crystal Structure of P. falciparum Aminopeptidase P in Complex With Apstatin [Plasmodium falciparum 3D7]
2WAO_A	5.04e-29	114	452	23	336	Chain A, ENDOGLUCANASE E [Acetivibrio thermocellus]
2WAB_A	1.25e-28	114	452	23	336	Chain A, ENDOGLUCANASE E [Acetivibrio thermocellus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0DZL3|AMPP1_LACBS	2.32e-178	542	1127	57	642	Probable Xaa-Pro aminopeptidase P OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) OX=486041 GN=AMPP PE=3 SV=1
sp|Q8RY11|AMPP2_ARATH	1.93e-174	536	1127	92	707	Aminopeptidase P2 OS=Arabidopsis thaliana OX=3702 GN=APP2 PE=2 SV=1
sp|A2QGR5|AMPP1_ASPNC	2.47e-171	541	1127	20	612	Probable Xaa-Pro aminopeptidase P OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=ampp PE=3 SV=1
sp|Q7RYL6|AMPP1_NEUCR	2.37e-170	541	1126	89	683	Probable Xaa-Pro aminopeptidase P OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=ampp PE=3 SV=2
sp|D1ZKF3|AMPP1_SORMK	5.35e-170	541	1126	19	613	Probable Xaa-Pro aminopeptidase P OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) OX=771870 GN=AMPP PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000040	0.000001

TMHMM  Annotations     

There is no transmembrane helices in EPrPAT00000014891-p1.