CAZyme Information: EPrPAT00000014471-p1

Basic Information

• Species: Pythium aphanidermatum
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium aphanidermatum
• CAZyme ID: EPrPAT00000014471-p1
• CAZy Family: AA17
• CAZyme Description: Alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1281		144045.57	4.4525

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PaphanidermatumDAOMBR444	12363	1223555	58	12305

• Gene Location: location=PaphDAOMBR444_SC0028:40354-44199(-)

Full Sequence      

MESDARDDKSYKEREGELLAELAALYTKLNQVREKRAKAEQEDSSALSTTDASSDVDAAN
ARRRRRRVVLVTRTLPFTLIADDDKSQWRAEFPENVSLDAAIETYLCLHETYDCVWIGSV
HGEIEQSEQSTLREQLLQDRNYYPVFLDPKREKLFYQGYCKTVMWPLFHSCPPTTEDQLT
QQEMDGDFGGSDDWNIERMWQAYVAVNQAFADAVQEVYEEGDLVWIQGYHLTLVPQMVQN
LFPNDNIHIGYFMHIPFPSSELYRIMNNREEILTGMLGADLIGFQTYEYARHFQSSAVRL
LGLESSHKGVDFNGHFARVTICPVGIDAEKFISLARSEAVNEQIRQLKAQFAGKKVMLGV
DQLDPTKGLVHKLLAVDDLFTMKPDLAQEVVFVQIVTGAVNQQDSPLGAQVEALVSRINS
KLQDIGADAPVQYLNQEIPVETLIALYALADALVITPVRDGMNTIPFEYVVCREAVGRHA
RVVLSEFAGSAHSLGGAKLINPWNTEELQVALLKSLEDCEEVMRSHQTMYSYVSTFTSRH
WADNFLEQLEECSEENALAVSGRELSRRDMTSAYIRSSKRLLFINYEGVLAAEASIPELS
YPPQELIWQLSMLTKDPRNTVVIVSARSTSVCEQWFAGLSGRIVLAAEYGVYVKWMGEQE
SWRCMVPNMDMSWWEHVVPLLEYYTERTPGAFIERKDSSVAWHYRDCDLDHGLWQASELL
ISLREITRSLPVAVVPGNRYLEVRPQKVSKVSLFERIWEYMNYSTLFPNEEPVDTDYFGD
IVNPLSSPLVKPMAATVDLKERFRKSSQEKADELAHFRLRDGSDENNRASEDGSHGAAGS
TVDFTEEDDGVDDQSPVDFVLVIASGDDRTDEDLFSVLVPPPIDLEAYCRQLEKEQMLGE
ALSESALLLHEENENRSSSMLISSGSRRRSWASNGAGAGVDDSLSMTHSSLDDSFERERM
SPKNSFRRLLSRESGSSNALTTAGIPTIDPELLPPPLTRLPSQGAEADFLLLGENITKLT
PLYNHASISKPAISEDAATMFPKALLTTPATARRDEITEKSKFTPRRDFPPSAALFKAMK
TKYGDNFGMHRLPDTPAACWALVIPPTARAKLEDQMGGMNTDRKISTGSGTLTSVNSRDL
DVDTIERDVAETSPLIDVLSPPPSFIDGDEEGILRIEEAITERTRSNSRMSDRLDEEEEG
PYLFPVNTFVCTLGRKLSQAPYYIKNSADLFQLLQEMGLSSHLRRQRQLSMSATGGGYDH
EAGSPVEDEYDDEDEEYEDDM

Enzyme Prediction     

EC	2.4.1.15:146

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	61	550	4e-147	0.9810526315789474

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	76	750	11	658	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	1.83e-163	76	550	10	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	6.03e-151	115	551	47	470	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215556	PLN03064	4.71e-144	112	757	134	776	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
177855	PLN02205	1.71e-140	110	794	103	813	alpha,alpha-trehalose-phosphate synthase [UDP-forming]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28038.1|GT20	0.0	7	1255	3	1243
CCA15235.1|GT20	0.0	12	1250	28	1218
QOX06485.1|GT20	1.58e-156	8	779	12	775
AJA04606.1|GT20	6.45e-152	15	757	65	806
AGT80036.1|GT20	6.45e-152	15	757	65	806

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HUV_A	2.93e-92	68	558	6	476	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	4.03e-92	68	558	6	476	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HVM_A	5.79e-91	68	564	14	489	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	1.33e-86	68	549	2	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVO_A	2.53e-85	56	553	1	478	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54K57|TPSA_DICDI	1.52e-143	54	757	4	673	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q54NU9|TPSB_DICDI	9.75e-135	100	783	82	752	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|Q9LRA7|TPS9_ARATH	5.69e-124	50	788	45	802	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana OX=3702 GN=TPS9 PE=2 SV=1
sp|Q0WUI9|TPS8_ARATH	2.23e-123	69	800	60	813	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana OX=3702 GN=TPS8 PE=2 SV=1
sp|Q9LMI0|TPS7_ARATH	1.96e-122	108	790	96	798	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 7 OS=Arabidopsis thaliana OX=3702 GN=TPS7 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000001

TMHMM  Annotations     

There is no transmembrane helices in EPrPAT00000014471-p1.