CAZyme Information: EPE10867.1

Basic Information

• Species: Ophiostoma piceae
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Ophiostoma; Ophiostoma piceae
• CAZyme ID: EPE10867.1
• CAZy Family: GT8
• CAZyme Description: FAD-binding PCMH-type domain-containing protein [Source:UniProtKB/TrEMBL;Acc:S3CD60]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
640		69703.87	6.4651

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_OpiceaeUAMH11346	8884	1262450	0	8884

• Gene Location: location=KE148146:3853092-3855014(+)

Full Sequence      

MAGNTTRADSKPVPTLNETYNGAPPRLQDEATEKRDKLAAMRTLPKNIQRKRGLQPPPGM
TADVFLAAIDELRAELKDTDNTLIQVNGSGIDLVDGWYLDRPATTHDAFHIADPEALVSS
ASIYPRSTADVQTIVRWANRHLTKSGDRVRGIPLYPISLGRNLGYGGAAPRVPGGVVLDL
GRNMHQILDLDGANASCVVEPGVSYFALYEAVQKLNNTKAHHPLWIDTPDLGGGSVLGNA
VDRGVGYTPYGDHFGNHCGMEVVLPDGSLLRTGMGALPGPPNGTDNSETDNPAWQSFQHS
FGPSIDGLFSQSSMGIVTKMGFQLMPAPPAHQSYCLTFPNEDDFSTIVEVIRPLAQRGVV
GNIPQLRHVVQELNITGKPKSLFRGGDTANTSPLTSDEIHAAAKQLPLGDCAWVFYGTQY
GTEQSTKDQIAEIEAAFKAVIPGTRLFLPKDVDPSHYLHDRALVCSGVPALRELDWLTWV
PNGAHLFFSPIAPTRGKDAETLHNLIKQLHVEYGFDLFPSLCVAGREMHYISNIVYDRGD
ADAKQRAVRLMRAMIAACAAHGFGEYRTHLLFADQVARTYSWGGQALLKFHETVKDAFDP
NGVLAPGRNGVWPRSYRGEGWELGVDDLSLDIIKPKAAKL

Enzyme Prediction     

EC	1.1.3.38:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA4	57	621	3e-180	0.9885057471264368

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
223354	GlcD	1.84e-28	90	609	7	455	FAD/FMN-containing dehydrogenase [Energy production and conversion].
396238	FAD_binding_4	1.85e-26	123	273	5	139	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
397178	FAD-oxidase_C	4.31e-07	501	607	142	246	FAD linked oxidases, C-terminal domain. This domain has a ferredoxin-like fold.
178402	PLN02805	5.12e-07	69	276	99	274	D-lactate dehydrogenase [cytochrome]
183043	PRK11230	1.06e-04	125	329	62	232	glycolate oxidase subunit GlcD; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS28313.1|AA4	1.22e-257	1	637	1	607
QKX53028.1|AA4	1.20e-233	12	623	9	591
AEO65530.1|AA4	1.86e-221	159	623	1	448
AEO67281.1|AA4	3.09e-201	13	623	11	586
BCS25303.1|AA4	4.96e-199	8	629	2	587

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1AHU_A	5.04e-166	49	623	5	560	Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With P-Cresol [Penicillium simplicissimum],1AHU_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With P-Cresol [Penicillium simplicissimum],1AHV_A Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 2-Nitro-P-Cresol [Penicillium simplicissimum],1AHV_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 2-Nitro-P-Cresol [Penicillium simplicissimum],1AHZ_A Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 4-(1-Heptenyl)phenol [Penicillium simplicissimum],1AHZ_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With 4-(1-Heptenyl)phenol [Penicillium simplicissimum],1VAO_A Structure Of The Octameric Flavoenzyme Vanillyl-alcohol Oxidase [Penicillium simplicissimum],1VAO_B Structure Of The Octameric Flavoenzyme Vanillyl-alcohol Oxidase [Penicillium simplicissimum],2VAO_A Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With Isoeugenol [Penicillium simplicissimum],2VAO_B Structure Of The Octameric Flavoenzyme Vanillyl-Alcohol Oxidase In Complex With Isoeugenol [Penicillium simplicissimum]
1W1K_A	5.04e-166	49	623	5	560	STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Ile238Thr Mutant [Penicillium simplicissimum],1W1K_B STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Ile238Thr Mutant [Penicillium simplicissimum]
1W1L_A	7.12e-166	49	623	5	560	STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Phe454Tyr Mutant [Penicillium simplicissimum],1W1L_B STRUCTURE OF THE OCTAMERIC FLAVOENZYME VANILLYL-ALCOHOL OXIDASE: Phe454Tyr Mutant [Penicillium simplicissimum]
1E8F_A	7.12e-166	49	623	5	560	Structure Of The H61t Mutant Of The Flavoenzyme Vanillyl- Alcohol Oxidase In The Apo Form [Penicillium simplicissimum],1E8F_B Structure Of The H61t Mutant Of The Flavoenzyme Vanillyl- Alcohol Oxidase In The Apo Form [Penicillium simplicissimum],1E8G_A STRUCTURE OF THE H61T DOUBLE MUTANT OF VANILLYL-ALCOHOL OXIDASE IN COMPLEX WITH FLUORO-CRESOL [Penicillium simplicissimum],1E8G_B STRUCTURE OF THE H61T DOUBLE MUTANT OF VANILLYL-ALCOHOL OXIDASE IN COMPLEX WITH FLUORO-CRESOL [Penicillium simplicissimum],1E8H_A Structure Of The H61t Mutant Of The Flavoenzyme Vanillyl- Alcohol Oxidase In The Apo Form Complexed By Adp [Penicillium simplicissimum],1E8H_B Structure Of The H61t Mutant Of The Flavoenzyme Vanillyl- Alcohol Oxidase In The Apo Form Complexed By Adp [Penicillium simplicissimum]
5MXU_A	2.02e-165	49	623	5	560	Structure of the Y503F mutant of vanillyl alcohol oxidase [Penicillium simplicissimum],5MXU_B Structure of the Y503F mutant of vanillyl alcohol oxidase [Penicillium simplicissimum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P56216|VAOX_PENSI	2.59e-165	49	623	5	560	Vanillyl-alcohol oxidase OS=Penicillium simplicissimum OX=69488 GN=VAOA PE=1 SV=1
sp|P09788|DH4C_PSEPU	2.66e-87	57	611	10	515	4-cresol dehydrogenase [hydroxylating] flavoprotein subunit OS=Pseudomonas putida OX=303 GN=pchF PE=1 SV=3
sp|P94535|GLCD_BACSU	1.24e-10	77	342	4	231	Glycolate oxidase subunit GlcD OS=Bacillus subtilis (strain 168) OX=224308 GN=glcD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EPE10867.1.