CAZyme Information: EPE10332.1

Basic Information

• Species: Ophiostoma piceae
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Ophiostoma; Ophiostoma piceae
• CAZyme ID: EPE10332.1
• CAZy Family: GT39
• CAZyme Description: Beta-galactosidase [Source:UniProtKB/TrEMBL;Acc:S3CBR8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1050	KE148146|CGC18	112605.03	5.9503

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_OpiceaeUAMH11346	8884	1262450	0	8884

• Gene Location: location=KE148146:1879344-1882836(+)

Full Sequence      

MKALWQAVLLAAALMLTVTAAGPVSWDRFSLSINGTRVFIQSGEFHYQRLPVPELWLDIF
QKLRANGFNTVSIYFFWSYHSAAPGVFDFTSPGKNVQLVLDMAKEAGLWVIARPGPYCNA
ETNAGSLALWGSDGSMGNLRTGDEKYHQAWGPWIAAIGEIIAKNEIGNGGPVILTQVENE
LTETVHVATNTLVVYMEQLKTALRAAGVTVPFTSNEKGMRGQSWSTDYQNVGGAVDVYGL
DSYPGGLSCTNPNSGFNVVRTYYQWFAAYAITQPVSFPEFEGGWFSAWGSATFYDQCASE
HSPGFADVFYKNNIGQRASNQNLYMAYGGTNWGHSAAPVVYTSYDYSAPIRETRQQTTKL
FQAKLINLFSTSSPDLLKTEMLGNGTGFQVSSQSIFTWVLRNPDTNATFSVLQQVSTPSL
NNVSTSVSLNTSAGAFSVPNVEIYGRQSKILVTDYVLGRGQSRRNALYYCTADIATSETF
DDQDVLVLYLKYGQTGEFAFKDLKAGGGAKTTFTTYGSSSVTSTARVSSSNKNLRAFNYT
QASGTTAVLFSNNVLVLLVEQTTAWRLWAPADGDVSLSSTPGKRLIILGPYLVRSARVDW
ARGVINVQGDNDVPTTLEAFIGKFGSNHWPAIHTISWNGRSIRATRTPYGSYTALIPGGR
DSLKDIDLPFLLQSNESTAAGVKWYAADSLPEADPDYDDSRWTICNKTSTLSPVAPVTLP
VLFSSDYGYYTGVKVYRGRFASAGDPTSVNITASGGLGFGWTAWVNGQFLGGIPGVGTDT
TTSAVLEFPEGSLFRGNGTNVITVLVDYHGHDETSTKNGLGNPRGLLGAKLVGKDGSSTS
PGFTSWKIAGNAGGPANIDAVRGPMNEGGLYGERLGWHLPGFDVAADKAFALSASGSSPF
DGIESAAGVRFYVTHFSFGGAAGTAPAIPANIDIPLGIKLSAPAGTVARVELWVNGYEYG
KYVPHIGPQTVFPIPPGIINTAAGETNTLALSLWAMTDAGAQLDYVAVVGYDGNVAYDTG
FFAANAANAKQWKTGIADLQPGWTDRSKFA

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	31	366	1.2e-82	0.9869706840390879

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396048	Glyco_hydro_35	1.91e-78	30	366	1	314	Glycosyl hydrolases family 35.
402180	BetaGal_dom2	1.00e-59	376	566	1	180	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyzes the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C-terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N-terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, pfam01301, which is N-terminal to it, but itself has no metazoan members.
198097	BetaGal_dom2	2.80e-34	375	567	1	182	Beta-galactosidase, domain 2. This is the second domain of the five-domain beta-galactosidase enzyme that altogether catalyses the hydrolysis of beta(1-3) and beta(1-4) galactosyl bonds in oligosaccharides as well as the inverse reaction of enzymatic condensation and trans-glycosylation. This domain is made up of 16 antiparallel beta-strands and an alpha-helix at its C terminus. The fold of this domain appears to be unique. In addition, the last seven strands of the domain form a subdomain with an immunoglobulin-like (I-type Ig) fold in which the first strand is divided between the two beta-sheets. In penicillin spp this strand is interrupted by a 12-residue insertion which forms an additional edge-strand to the second beta-sheet of the sub-domain. The remainder of the second domain forms a series of beta-hairpins at its N terminus, four strands of which are contiguous with part of the Ig-like sub-domain, forming in total a seven-stranded antiparallel beta-sheet. This domain is associated with family Glyco_hydro_35, which is N-terminal to it, but itself has no metazoan members.
404274	BetaGal_dom4_5	1.29e-30	871	999	1	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.
404274	BetaGal_dom4_5	1.35e-28	697	812	1	111	Beta-galactosidase jelly roll domain. This domain is found in beta galactosidase enzymes. It has a jelly roll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UQC78589.1|GH35	0.0	24	1050	29	982
APA12177.1|GH35	0.0	24	1045	28	978
ATZ49456.1|GH35	0.0	24	1050	28	987
CCD45102.2|GH35	0.0	24	1050	28	987
QSZ31820.1|GH35	0.0	24	1043	28	975

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1TG7_A	3.44e-154	24	1004	6	939	Native structure of beta-galactosidase from Penicillium sp. [Penicillium sp.],1XC6_A Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose [Penicillium sp.]
3OG2_A	1.01e-148	20	1008	18	975	Chain A, Beta-galactosidase [Trichoderma reesei],3OGR_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGS_A Chain A, Beta-galactosidase [Trichoderma reesei],3OGV_A Chain A, Beta-galactosidase [Trichoderma reesei]
5IFP_A	2.54e-148	24	1004	46	975	Structure Of Beta-galactosidase From Aspergillus Niger [Aspergillus niger CBS 513.88]
5IFT_A	6.96e-148	24	1004	46	975	STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 3-b-Galactopyranosyl glucose [Aspergillus niger CBS 513.88],5IHR_A Structure Of E298q-beta-galactosidase From Aspergillus Niger In Complex With Allolactose [Aspergillus niger CBS 513.88],5JUV_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-b-Galactopyranosyl galactose [Aspergillus niger CBS 513.88],5MGC_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 4-Galactosyl-lactose [Aspergillus niger CBS 513.88],5MGD_A STRUCTURE OF E298Q-BETA-GALACTOSIDASE FROM ASPERGILLUS NIGER IN COMPLEX WITH 6-Galactosyl-lactose [Aspergillus niger CBS 513.88]
4IUG_A	8.00e-148	24	1003	46	972	Crystal structure of beta-galactosidase from Aspergillus oryzae in complex with galactose [Aspergillus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0Y752|BGALC_ASPFC	0.0	24	1050	32	983	Probable beta-galactosidase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=lacC PE=3 SV=1
sp|B6H5X9|BGALC_PENRW	0.0	24	1021	30	961	Probable beta-galactosidase C OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) OX=500485 GN=lacC PE=3 SV=1
sp|A7EZS5|BGALC_SCLS1	0.0	24	1045	28	978	Probable beta-galactosidase C OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) OX=665079 GN=lacC PE=3 SV=1
sp|Q2UMD5|BGALC_ASPOR	0.0	24	1050	32	984	Probable beta-galactosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=lacC PE=3 SV=1
sp|B8N2I5|BGALC_ASPFN	0.0	24	1050	32	984	Probable beta-galactosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=lacC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000248	0.999707	CS pos: 20-21. Pr: 0.9868

TMHMM  Annotations     

Start	End
7	26