CAZyme Information: EPE09806.1

Basic Information

• Species: Ophiostoma piceae
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Ophiostoma; Ophiostoma piceae
• CAZyme ID: EPE09806.1
• CAZy Family: GT24
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:S3CCT0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
854		92694.67	4.7362

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_OpiceaeUAMH11346	8884	1262450	0	8884

• Gene Location: location=KE148147:2786133-2788697(-)

Full Sequence      

MLSESEIDHVVQQLTLEEKVSMLAGQNSWETRAIDRLSIPALKVTDGPNGARGEHFLDGP
TAACFPASVSLASTFDKDLAWKIGQALGDEAQTKGAHVLLGPTVCLHRSPLGGRNFEAFS
EDPLLSGAMAAGYVKGMQEGSRVGATVKHYAANEQETRRFDVDETVSQRALREIYLKPFE
IVVKDADPWCMMMAYNKVNGKHIDDQPSLLIDVLRDQWGWTGLMMSDWGACSNVGNSIKY
GLDLEMPGPPIRRKFGPVKAALDAGECTIENIDSKIKLLLRLLNKTGKFDDRREPVAEHS
VRVPAHEQLIRQAGADGMVLLKNDNNTLPLAPKTLKKIALLGPLAKTASAHGGGSASLNC
HYKVSAYDAFVERLGSDVEITTAPGAHIFRVYPPMTESIYADAEKTIAGFKGEYFLAREA
SANLDAVPYHAQIYLRSQLDTLLNETVAEAKSARYTATFVPTKSGKHYWSYSSCGPSTMY
IDGQEVANQPQDTLDSMPFVVGAQDELRFQHDMVAGQAYELRVVTERPLGCIGDLPLLAD
VMGAHIGFVYQDEMERDLLGEAVALATAADFAIVFVGNNTMWETEGLDMETMALPTDGSQ
DTLVAAVAAVNPKTVVVLTTGTAKDLPWLDSVPALVQTWYAGQEAGNSLLDVLLGDVNPS
GKLPFSWPRRIEDMPSYGHFGLDAYDTRKVEYKEGVYVGYRHFDRHATDPTINTPLFPFG
YGLSYTDFAVDSASVEGTLSSDLSKKVVVSATVRNTGQAAGAESVQVYVVPPSGGIDRPI
KELGGFAKVFLQPGESQTVTITLDRTNAAYWDETTDKWAVAAGDHELLVAHSSAADGGDV
KLSLPSENAFFFDA

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	33	247	8e-63	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	7.49e-78	7	835	38	756	beta-glucosidase BglX.
224389	BglX	9.00e-66	29	346	50	365	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
178629	PLN03080	4.75e-53	10	847	56	778	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	1.93e-50	318	700	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	6.68e-30	36	282	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPL02780.1|GH3	9.16e-296	4	854	7	828
EAA65189.1|GH3|3.2.1.21	2.34e-245	5	848	9	842
ABF50843.1|GH3|3.2.1.21	2.34e-245	5	848	9	842
QRC93387.1|GH3	1.69e-243	7	834	5	818
QKD46840.1|GH3	7.43e-239	2	842	1	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	5.06e-180	2	833	1	825	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	6.60e-174	3	833	2	825	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.91e-127	6	833	4	657	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.16e-117	11	833	9	652	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	6.26e-105	5	836	52	819	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	4.15e-246	5	848	9	842	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|A1CA51|BGLI_ASPCL	1.12e-185	6	829	5	815	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	9.58e-181	6	829	5	815	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	3.79e-180	6	829	5	815	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1
sp|P27034|BGLS_RHIRD	4.59e-179	7	848	2	814	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999948	0.000084

TMHMM  Annotations     

There is no transmembrane helices in EPE09806.1.