CAZyme Information: EPE09621.1

Basic Information

• Species: Ophiostoma piceae
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Ophiostoma; Ophiostoma piceae
• CAZyme ID: EPE09621.1
• CAZy Family: GT20
• CAZyme Description: Mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:S3CCB7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
521	KE148147|CGC9	59486.56	9.8935

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_OpiceaeUAMH11346	8884	1262450	0	8884

• Gene Location: location=KE148147:2100236-2102198(-)

Full Sequence      

MWRRAYLFLILVRLWFAMSPSYLHPDENFQGPEVIAGEVFSYPVRHTWEFTSDHPIRSVF
PLWPVYGLPMFLLRWLWIGNGGDGEIPPHVVFWVLRVLMFIMNFVLLDWAIYELVPAKRH
RQTAVLLVASSYVTWTYQTHTFSNSVETLVVAWSLVLIERIVAGRDRSSFLAPTVLGIVV
VFGIFNRITFPAFLIIPGIRLLPYFLKKPLSGLAMAGSGLFTTIVAIGFDTAFYTPHQIT
WADLLFRPVITPLNNLFYNMVPSNLAQHGIHPWYQHTLGNIPLLIGPAAALLFLQPHLSM
RLYSALSGVAVLSLFQHQEARFLLPSIPLILSSVRLPRNKPRLFNAWLAVWIGFNTVLGI
LMGIYHQGGVVPTQIFMSRQPDATTAIWWKTYSPPIWLLNGKNEVLNTRDVMGMPGDTLM
EQLTAIATCDTPADRRNSEYLKEKNGTYLIAPLSSSFLDPYLPNKGLDGLRFREVWRYRQ
HLNLDDLDWGEDGVWNTLSRVVGRRGIAAWRVTKSCNPQRR

Enzyme Prediction     

EC	2.4.1.-:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	6	398	6.8e-76	0.987146529562982

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
281842	Glyco_transf_22	7.29e-50	5	397	2	410	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.
215437	PLN02816	2.98e-04	3	331	39	351	mannosyltransferase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UNI14407.1|GT22	1.02e-306	1	516	1	515
AEO57845.1|GT22	2.56e-306	1	516	1	515
QLI65346.1|GT22	4.40e-305	1	516	1	515
UQC77828.1|GT22	1.36e-302	1	516	1	515
QPC74020.1|GT22	1.16e-301	1	516	1	515

PDB Hits     

EPE09621.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4I785|SMP3_GIBZE	2.92e-302	1	516	1	515	GPI mannosyltransferase 4 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=SMP3 PE=3 SV=2
sp|Q2UTP0|SMP3_ASPOR	5.70e-189	1	517	1	543	GPI mannosyltransferase 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=smp3 PE=3 SV=1
sp|Q4WTT7|SMP3_ASPFU	9.63e-176	1	510	1	539	GPI mannosyltransferase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=smp3 PE=3 SV=2
sp|Q5BAX7|SMP3_EMENI	6.96e-173	1	510	1	534	GPI mannosyltransferase 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=smp3 PE=3 SV=2
sp|Q6CDD0|SMP3_YARLI	1.56e-99	10	488	13	495	GPI mannosyltransferase 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=SMP3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000471	0.999484	CS pos: 17-18. Pr: 0.9537

TMHMM  Annotations     

Start	End
59	78
93	115
175	197
212	234
343	365