CAZyme Information: EPE09331.1

Basic Information

• Species: Ophiostoma piceae
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Ophiostoma; Ophiostoma piceae
• CAZyme ID: EPE09331.1
• CAZy Family: GT2
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:S3CBK1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
869		93660.79	5.1434

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_OpiceaeUAMH11346	8884	1262450	0	8884

• Gene Location: location=KE148147:1012002-1014611(+)

Full Sequence      

MASRIETLIGAMTLEEKCFFVAGKNMWETLDIERLGIRSLKFTDGPAGVRGATWIDGTHT
TYVPCGISLGATFDGELVERIGNILGAETHSKRSHVLLAPTMNISRSPLGGRNFENFGED
PFLTGVLATHYIRGVQAKHKDGTGVGACMKHFVANDMETRRFNMDEQIDERTLREVYLKP
FQLVMERGGDPWTAMTAYPKINGEHADCSTFLIDDILRKEWGFKGLVMSDWGGLNDTVDS
IVAGTDVEMPGPPIRYGNALLAAVKEGKVSETTHLDAAARNILYVLERAGLLDPEPTTET
GSKTEKNSDLPEFRQTARDAAAGAIVLLKNTDNAVLPLDPSKIKTLAIIGPNAKTPTTGG
TGSAAVNPYYITNPLESITEAAKKINPDIEIVYEQGIRTNLQPTLPGAMLLTPPDTTDSG
SQKPGVQVDFYAGHEFSGPVVASSHWANSVMFMMSDGDTPDALRGKQHCYRASGILKPTV
SGVYQFSLSNTGQAKLYLDNELFVDNTGWKIPGGTFMNCGSVNKVATHNLVAGQPYDFRI
DNVVVPPPLKPHDNTLFHTLSGVRVGVQLQIDEDALFAKAVEAAKAADAVVLVVGHNNDT
EKEGTDRTSLLLPRRTNELVAAVCAVSDPKSTAVVTQSASAISMPWADAAPAIVHAWFQG
QENGNALADILLGTVSPSGKLPITFPHHLEDHGSHQWFPGDAENDLATYGEGVLVGYRYF
DAKADSVVPMWPFGYGLSYTTFSITDITVQDILSKQSKTAIRATVTNTGSRAGAEVIQVY
VSPSPVIKEQGKAAAPRSLAGFTKVFLEAGATKTVEVDLDSSCVAWFDVDQVHRDTGKNG
VWRVDAGTYTCYVGTSSSDFVKAVDLVVE

Enzyme Prediction     

No EC number prediction in EPE09331.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	32	250	3.9e-61	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	1.61e-69	24	361	47	372	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.34e-62	59	820	116	726	beta-glucosidase BglX.
395747	Glyco_hydro_3	1.41e-36	34	283	63	314	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	7.68e-36	3	820	51	743	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	7.40e-34	325	717	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS28473.1|GH3	0.0	3	869	9	854
CAP99712.1|GH3	6.76e-318	5	859	10	836
QMW31943.1|GH3	4.63e-316	3	859	7	842
QMW43976.1|GH3	3.76e-315	3	859	7	842
BAE61700.1|GH3	2.00e-312	3	859	7	842

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	5.02e-152	5	869	6	837	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.93e-147	5	869	6	837	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	1.95e-116	1	861	1	661	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.64e-100	9	859	9	654	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	4.94e-99	3	859	52	819	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	2.00e-169	3	869	9	839	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|A1DNN8|BGLJ_NEOFI	5.37e-168	5	851	14	846	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	1.45e-167	5	847	6	820	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|B0Y3M6|BGLI_ASPFC	3.93e-167	5	863	6	825	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1
sp|Q4WU49|BGLI_ASPFU	1.55e-166	5	863	6	825	Probable beta-glucosidase I OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000001

TMHMM  Annotations     

There is no transmembrane helices in EPE09331.1.