CAZyme Information: EPE08972.1

Basic Information

• Species: Ophiostoma piceae
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Ophiostoma; Ophiostoma piceae
• CAZyme ID: EPE08972.1
• CAZy Family: GT15
• CAZyme Description: Endo-1,3(4)-beta-glucanase [Source:UniProtKB/TrEMBL;Acc:S3C810]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
855	KE148148|CGC2	92726.92	6.4108

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_OpiceaeUAMH11346	8884	1262450	0	8884

• Gene Location: location=KE148148:1849702-1852407(+)

Full Sequence      

MKMLAGATLFALGLLASPASTTPFGSSPIHDVTSAPAAIASDINSSSSRNDTVQTRCSYS
QTSCPHSLPKLKSHRFDKTRKFSSSSPPPSTAPLSSSVVQPRHCHCTSPASPFPGIGSMD
LFASPINEGAEAGALPAQIKSRPDHPQAPLGTTPASRKASGPIETNKFYANLMLGDQDFP
AYMMPYSVSWTKGRAPTSGWGLTVSYVTPEMRVFGPNDGPCHHHSSPNSYFFSPPVLQNF
VLDATELNDKTVMTVENQTDMSTMVSLRSGGPEAAPTIQFPLVQGQGFVTGLYDGACPLI
RSAQAFLSVDSACAGLKQGVQRYVVQMNDNSTWLIYARSQSGSPSIDLRQNSPTSLQAQQ
GFCGSIQMARVLDPAQGYASYDQAAGVFASGVTLSGQTSSNGAAGTYTFAFNKSDVANDA
SFMSSSPLLMFALPHHYASFDDKTKGALQNIEMQTTTKGGARAVLGDSWTMVEPELPVDL
GFLPWDHKSKKTINAISASSHEAILSIARQEIAQDMNAQTDLDSMYYSGKGLAKFASILL
AVSELLHDKETAATGLAKLKESFARFTENRQIHPLVYESAWGGVVSTASYTLNDPNVDFG
NSYYNDHHFHYGYFVYAGAVIAHLDPSWLKDNEAFVDTLVRDYANPSHKDKLFPVFRSFD
WYHGHSWAHGLFASMDGKDQESSSEDAMSVYALKLWGMAKGDAVLEARGNLMLAVQARSL
QTYYYYEQGNNVEPSGFIGNQVAGIMFENKIDHTTYFGNAPEYIHGIHMIPLLPCSPYFR
KPSYVMQEWNDIFANGKADSVPGGWRGILYGNLATLDPHAAFKFFSQANFDPSWLDGGAS
RTWYLSYAAVLAGGL

Enzyme Prediction     

EC	3.2.1.39:20

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	152	847	1.3e-220	0.9855305466237942

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	0.0	108	853	41	757	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	0.0	495	845	1	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	3.43e-127	145	486	1	320	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO64126.1|GH81	3.37e-269	116	853	164	874
AEO58881.1|GH81	9.96e-265	75	851	61	837
QSZ30780.1|GH81	1.46e-262	136	853	65	760
APA08036.1|GH81	6.19e-252	108	853	163	888
ATZ48291.1|GH81	1.03e-249	68	853	97	864

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XBZ_A	9.60e-96	114	849	20	741	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K3A_A	1.08e-95	136	849	17	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
4K35_A	5.68e-93	163	849	41	716	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.12e-36	511	828	326	637	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	7.23e-25	403	841	255	674	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	6.35e-220	107	849	179	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.52e-167	145	853	21	704	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	2.88e-155	152	849	449	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	1.07e-149	136	851	57	737	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	2.22e-142	161	852	432	1113	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000478	0.999495	CS pos: 21-22. Pr: 0.9240

TMHMM  Annotations     

There is no transmembrane helices in EPE08972.1.