CAZyme Information: EPE07182.1

Basic Information

• Species: Ophiostoma piceae
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Ophiostoma; Ophiostoma piceae
• CAZyme ID: EPE07182.1
• CAZy Family: GH5
• CAZyme Description: Glycoside hydrolase [Source:UniProtKB/TrEMBL;Acc:S3C342]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402	KE148151|CGC1	44293.22	6.6860

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_OpiceaeUAMH11346	8884	1262450	0	8884

• Gene Location: location=KE148151:323862-325070(-)

Full Sequence      

MQITQLAALAAFSASVLAYGTKDVRNLHVTRNKSQLLLDGKPWKAVGANIYWLGLDENVI
PKDKSAPFYAPYNASYPTKGRVSEIMDTVRTLGGTAIRAHTLGVSTGCPLSIWPAPHETN
AQAFEAIDWAVYQARLYGLRLLVPLTDNYAYYHGSKFDFLQWAGYNISGTDRTNPIVAKF
YTNETVIALYHDYIRALITHRNPYTKLTYAEDPTIFAFETGNELTGPVWLDMDIPVSWLQ
STARLLKQLAPAKLVVDGTYGINGSHLTVDEVDIVSNHFYPLNATKVRENADLAVSGGKV
FLAGEYSWTSPGLEAFFSELENHPGVGGDMFWSLFGHNVPDCSTYVDHVDGFTLQYGNPL
NSADTNARIKLIRQHLMAAGQKKSITADAALPPVACPGCRVH

Enzyme Prediction     

No EC number prediction in EPE07182.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	86	338	6.3e-42	0.96484375

CDD Domains     

EPE07182.1 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBD78350.1|GH5	9.82e-93	29	398	37	369
CDR37878.1|GH5	1.61e-90	29	397	231	586
SBT43460.1|CBM23|GH5	3.68e-77	29	356	48	356
QHW31793.1|GH5	9.49e-77	29	382	7	331
ATO15951.1|CBM23|GH5	1.00e-74	29	356	48	356

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RH9_A	1.04e-15	26	281	4	254	Chain A, endo-beta-mannanase [Solanum lycopersicum]
3PZ9_A	1.11e-15	37	354	21	365	Native structure of endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZG_A I222 crystal form of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3PZI_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with beta-D-glucose [Thermotoga petrophila RKU-1],3PZM_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with three glycerol molecules [Thermotoga petrophila RKU-1],3PZN_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with citrate and glycerol [Thermotoga petrophila RKU-1],3PZO_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 in complex with three maltose molecules [Thermotoga petrophila RKU-1],3PZQ_A Structure of the hyperthermostable endo-1,4-beta-D-mannanase from Thermotoga petrophila RKU-1 with maltose and glycerol [Thermotoga petrophila RKU-1]
6TN6_A	1.26e-15	37	388	7	378	X-ray structure of the endo-beta-1,4-mannanase from Thermotoga petrophila [Thermotoga petrophila RKU-1]
4QP0_A	4.86e-11	35	352	11	336	Crystal Structure Analysis of the Endo-1,4-beta-mannanase from Rhizomucor miehei [Rhizomucor miehei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9LZV3|MAN6_ARATH	3.45e-24	29	319	48	314	Mannan endo-1,4-beta-mannosidase 6 OS=Arabidopsis thaliana OX=3702 GN=MAN6 PE=2 SV=1
sp|Q9LW44|MANP_ARATH	3.20e-20	29	264	30	243	Putative mannan endo-1,4-beta-mannosidase P OS=Arabidopsis thaliana OX=3702 GN=MANP PE=5 SV=3
sp|Q5W6G0|MAN5_ORYSJ	1.31e-19	30	297	80	310	Putative mannan endo-1,4-beta-mannosidase 5 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN5 PE=2 SV=2
sp|Q9SG95|MAN4_ARATH	4.87e-19	29	264	30	243	Putative mannan endo-1,4-beta-mannosidase 4 OS=Arabidopsis thaliana OX=3702 GN=MAN4 PE=3 SV=1
sp|Q0IQJ7|MAN8_ORYSJ	2.20e-18	34	278	7	231	Mannan endo-1,4-beta-mannosidase 8 OS=Oryza sativa subsp. japonica OX=39947 GN=MAN8 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000268	0.999681	CS pos: 18-19. Pr: 0.9785

TMHMM  Annotations     

There is no transmembrane helices in EPE07182.1.