CAZyme Information: EPE06628.1

Basic Information

• Species: Ophiostoma piceae
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Ophiostoma; Ophiostoma piceae
• CAZyme ID: EPE06628.1
• CAZy Family: GH37
• CAZyme Description: Glycosyltransferase family 32 [Source:UniProtKB/TrEMBL;Acc:S3CJL1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
348		40273.90	9.7953

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_OpiceaeUAMH11346	8884	1262450	0	8884

• Gene Location: location=KE148153:1426971-1428157(+)

Full Sequence      

MMSTNLFFVRLPRLRQVVIFTPILILVALIWHYHEVIGLGFTLATLPINWFRDSSTWLIS
KENDGFDVSFANYSIHQTTAGDGYEDRVPAILHHIMLGSKKPMEGWNDARQTCIDLHPGW
ESMQWTDEKAEKLVSEKFPDFKPTWDGYKLPIQRVDTLRYMILYEYGGVILDMDVQCKRA
LGPLRRFEFVVPAAYPTGFSVSFMMSSKRNEFIGALIKKWLKLYDRQWFYLPYVTVMMST
GGHFASAIHVMWPDRSSLKVLAGPKDNFKLHTINGRVSTPLFNHLGSSSWHSYDGLFIML
LGKYLKWILIGLSVSFIGSLLCVTGMSRRRRGRSPSRKEREDLEKRLE

Enzyme Prediction     

No EC number prediction in EPE06628.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	106	184	2.6e-18	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	8.49e-23	68	249	61	240	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	5.37e-15	104	188	2	90	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CDP31789.1|GT32	4.04e-114	23	331	44	364
CAP68318.1|GT32	4.04e-114	23	331	44	364
VBB86275.1|GT32	5.72e-114	23	331	44	364
AEO68738.1|GT32	8.38e-114	40	316	39	319
ANH56537.1|GT32	3.29e-112	18	303	18	298

PDB Hits     

EPE06628.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	7.05e-37	88	294	55	255	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	4.63e-35	88	305	62	274	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	7.09e-32	85	321	79	313	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	2.33e-31	70	298	31	262	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	4.30e-31	61	333	39	305	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999967	0.000031

TMHMM  Annotations     

Start	End
15	34
228	250
304	323