CAZyme Information: EPE06562.1

Basic Information

• Species: Ophiostoma piceae
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Ophiostoma; Ophiostoma piceae
• CAZyme ID: EPE06562.1
• CAZy Family: GH32
• CAZyme Description: Chitobiosyldiphosphodolichol beta-mannosyltransferase [Source:UniProtKB/TrEMBL;Acc:S3C1E1]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476	KE148153|CGC1	51100.53	9.9907

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_OpiceaeUAMH11346	8884	1262450	0	8884

• Gene Location: location=KE148153:1183003-1184433(-)

Full Sequence      

MPLGFSVIGATLLAVVVIGVLAWPRRYNARRRAPAVQVLVLGDVGRSPRMQYHALSIAER
GHVQLIGYYETPLVDALDKHPRLTKVALAPPPPALRGLPFIIGGPLKVVWQVADLFLTLA
YTTRPARWLLVQNPPSIPTLLIAGIVAPLRGTRLVIDWHNYGWSILAGTRGPKHPFVAVA
KVYESIVGRIAGDAHLAVTAAMADELRKPPYNLAHAGPTAVTLSGIASSKAATLAVLHDR
PAALFQPAMPSFPAAPARLQQLSEILGDDTTAAVTALLRNTTTKIIVSSTSWTPDEDFQL
LLDALVEYVKTTSSPQRPPILAVITGKGPQKKMYERKLQALADSGALPPAQIAVCTAFLP
MRDYARLLALADLGVCLHMSSSGVDLPMKVVDMFGAGLPVAAYSAYASFGELVRDGENGR
GFTTSGELASLLATLLGSSSEIGRLRDGARKESRLRWSEEWNRVVAPILDLGDKKE

Enzyme Prediction     

EC	2.4.1.142:10	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT33	35	467	4e-132	0.9905882352941177

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340843	GT33_ALG1-like	0.0	29	469	2	411	chitobiosyldiphosphodolichol beta-mannosyltransferase and similar proteins. This family is most closely related to the GT33 family of glycosyltransferases. The yeast gene ALG1 has been shown to function as a mannosyltransferase that catalyzes the formation of dolichol pyrophosphate (Dol-PP)-GlcNAc2Man from GDP-Man and Dol-PP-Glc-NAc2, and participates in the formation of the lipid-linked precursor oligosaccharide for N-glycosylation. In humans ALG1 has been associated with the congenital disorders of glycosylation (CDG) designated as subtype CDG-Ik.
215155	PLN02275	1.05e-120	30	436	4	371	transferase, transferring glycosyl groups
340831	GT4_PimA-like	3.25e-11	136	471	90	364	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
223515	RfaB	1.96e-09	50	471	1	373	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
340844	GT4_UGDG-like	1.02e-04	298	430	216	332	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ55236.1|GT33	9.35e-152	35	471	38	454
AEO55016.1|GT33	1.08e-142	35	469	53	483
VBB84667.1|GT33	1.57e-141	6	469	3	445
QSZ29941.1|GT33	2.79e-139	35	473	14	430
UQC76213.1|GT33	7.92e-138	2	473	5	467

PDB Hits     

EPE06562.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZD1|ALG1_ARTBC	2.67e-86	71	471	68	445	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01551 PE=3 SV=1
sp|O13933|ALG1_SCHPO	2.73e-86	27	469	16	420	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg1 PE=3 SV=2
sp|Q6C3K2|ALG1_YARLI	1.12e-78	28	473	35	442	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=ALG1 PE=3 SV=1
sp|Q921Q3|ALG1_MOUSE	1.11e-76	10	469	12	461	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg1 PE=1 SV=3
sp|Q9BT22|ALG1_HUMAN	6.26e-74	25	469	24	461	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000021	0.000009

TMHMM  Annotations     

Start	End
2	24