CAZyme Information: EPE06554.1

Basic Information

• Species: Ophiostoma piceae
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Ophiostoma; Ophiostoma piceae
• CAZyme ID: EPE06554.1
• CAZy Family: GH31
• CAZyme Description: Chitinase [Source:UniProtKB/TrEMBL;Acc:S3BZ52]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1516	KE148153|CGC2	162056.31	4.4708

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_OpiceaeUAMH11346	8884	1262450	0	8884

• Gene Location: location=KE148153:1161298-1165848(+)

Full Sequence      

MHSWLSSTATALLAASGLVGGADAMRLRQPAAPNYRARGSECPSTCVEAGPNPANWTAYG
SLNNLQRCNQTLFYHFSLHDMVDDNSVHRIYACASTGETKAGSRIAGPKAAADPETITNA
AFSVGRWDENAEQGIDLASISQHVRAFLNSGYQSSTPGAEVLYAQSNGSTVGLYVGKAIK
SFTTVTAALATLEKKLTASSGTSGAVALELCGKGYDSDHIFGFVATSNASFTPVQQLMQG
WSSATCQSFDSDLSFAGSVTFTTPLVIAGSNSTGNGTLTRGNSTLSGRSATAHHHMNLRN
AHRRSHALGQLYRRDECSTVQVVSGDSCGTLATKCGVSGDDFTKYNPGKSFCADLTPGQH
VCCSSGELPDFAPHKQSNGSCYAYNVVADDNCASISATYDLTNDKIEGFNNNTWGWQGCQ
NLLLGAVICLSDGAPPMPSELTNAVCGPQKPGTVVGSGGTTNLSSLNPCPLNACCDIWGQ
CGITSDFCTDTSTGPPGTAKAGTNGCISNCGTDIVKGDAPSSYINIAYYEGFGLNRSCLF
QDISQLGSGYTHVHFSFATLDSSYNVDVGDVYSQFELKRLISNTAYHRVLTFGGWAFSTE
PATYSIFREGVTAANREAMASAMANYINDNDLDGVDIDWEYPGAPDIPGIPAGGDDDGAN
YLAFLKVLKGKLPNKTVSIAAPSSYWYLKAFPIAEISKVVDYVVFMTYDLHGQWDSDNSW
SQEGCANGNCLRSHVNITETMTSLAMVTKAGVNSGKVIVGVTSYGRSFGMEDGSCWTPGC
TYGGSAGESTAAKGLCTDTAGYLADAEIYDIISGTSSTVTRKKRSDPSNIFAVRADTSSA
RVSQYYYDSDSDSQILVYDNDQWVAFMTSDILSSRTEKYKSYNLGGVTNWASDLEVFYEA
PQSYTTWNQFKNLVADGSVAPGSDYSDVTRTGNWTDLTCGDIAVSNVKTLTPYERWHRLD
CDDAWNDIKGQWLEDREHKTSFSSSLQANLHMKEDIDCTVVGTSGQCSQTTECENFQKSD
LGPAAFLIWNSLVLVHNMYSHYHDTLHDLADTLFGSSLDLFMDEFAPVVPKDNTWLDILL
ATIGFVGTIGASALFNSVLKALPFFRANGAIYDNLKDTAKALVSYSVSITGIYVSGSESS
WTAESQDSFKAYMGQTIDAWDTINSNTLAQVFDGSDNSLDMLWTIISDGKLTEGGVDGGV
VPVSIDADNNTLKNSINGGFYAASIPAVWRLSGKAAFIMDTGVGCSDSVPDTLSDDDAKV
SNACIDDKLYLLGYPKGGYDDHCNAHGDGCDPTKFKLPPGYDALDGSAWGGVTLENLIKA
SVISYRANGNKNGGALPDFTSEDTVDSILDSIDGDSTLPAYLTTPGVVRLPVCSPDYAIA
QWKRFGDSSLENYPCYIQPPPDFCEISNFFNQGSDASPSVDDCMQIVAQVQGTQKTWQVN
TAGLAQKKLISYGSCHFGAQASNLHGNIYFHVGSQDVVDLITDAVNKFATNGKIGARGDM
DCKGNINSQDMSWGIY

Enzyme Prediction     

EC	3.2.1.14:3	3.2.1.14:3	3.2.1.14:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	525	894	1e-45	0.9256756756756757

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119357	GH18_zymocin_alpha	6.26e-169	525	895	2	345	Zymocin, alpha subunit. Zymocin is a heterotrimeric enzyme that inhibits yeast cell cycle progression. The zymocin alpha subunit has a chitinase activity that is essential for holoenzyme action from the cell exterior while the gamma subunit contains the intracellular toxin responsible for G1 phase cell cycle arrest. The zymocin alpha and beta subunits are thought to act from the cell's exterior by docking to the cell wall-associated chitin, thus mediating gamma-toxin translocation. The alpha subunit has an eight-stranded TIM barrel fold similar to that of family 18 glycosyl hydrolases such as hevamine, chitolectin, and chitobiase.
214753	Glyco_18	1.25e-41	526	894	3	333	Glyco_18 domain.
395573	Glyco_hydro_18	1.22e-39	526	893	3	305	Glycosyl hydrolases family 18.
405536	Hce2	1.15e-32	1403	1502	1	103	Pathogen effector; putative necrosis-inducing factor. The domain corresponds to the mature part of the Ecp2 effector protein from the tomato pathogen Cladopsorium fulvum. Effectors are low molecular weight proteins that are secreted by bacteria, oomycetes and fungi to manipulate their hosts and adapt to their environment. Ecp2 is a 165 amino acid secreted protein that was originally identified as a virulence factor in C. fulvum, since disruption reduces virulence of the fungus on tomato plants. We have recently determined that Ecp2 is a member of a novel, widely distributed and highly diversified within the fungal kingdom multigene superfamily, which we have designated Hce2, for Homologs of C. fulvum Ecp2 effector. Although Ecp2 is present in most organisms as a small secreted protein, the mature part of this protein can be found fused to other protein domains, including the fungal Glycoside Hydrolase family 18, Glyco_hydro_18 pfam00704 and other, unknown, protein domains. The intrinsic function of Ecp2 remains unknown but it is postulated by that it is a necrosis-inducing factor in plants that serves pathogenicity on the host.
119365	GH18_chitinase	1.27e-32	525	768	1	266	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO70565.1|CBM18|CBM50|GH18	0.0	27	1516	29	1480
EAA35795.2|CBM18|CBM50|GH18	0.0	21	1516	85	1528
QGA14670.1|CBM18|CBM50|GH18	0.0	27	1516	34	1488
EAA32694.1|CBM18|GH18	0.0	6	1516	4	1484
BCS04716.1|CBM18|GH18	0.0	31	1516	32	1462

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JM7_A	5.84e-19	560	918	52	375	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]
5Y29_A	2.09e-18	551	895	37	351	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 [Ostrinia furnacalis],5Y2B_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with HEPTA-N-ACETYLCHITOOCTAOSE (NAG)7 [Ostrinia furnacalis]
6JAV_A	2.40e-18	551	895	37	351	Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a piperidine-thienopyridine derivative [Ostrinia furnacalis],6JAW_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a napthalimide derivative [Ostrinia furnacalis],6JAX_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with chitooctaose [(GlcN)8] [Ostrinia furnacalis],6JAY_A Crystal structure of Ostrinia furnacalis Group II chitinase catalytic domain 1 in complex with a dipyrido-pyrimidine derivative [Ostrinia furnacalis]
5WUS_A	2.58e-18	551	897	32	344	Crystal structure of a insect group III chitinase (CAD2) from Ostrinia furnacalis [Ostrinia furnacalis],5WVH_A Crystal structure of an insect group III chitinase complex with (GlcNAc)6 (CAD2-(GlcNAc)6) from Ostrinia furnacalis [Ostrinia furnacalis]
6JM8_A	6.00e-18	560	918	52	375	Crystal structure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P09805|KTXA_KLULA	1.18e-98	330	893	203	710	Killer toxin subunits alpha/beta OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 PE=1 SV=1
sp|E9ERT9|CHI1_METRA	1.74e-18	513	895	29	384	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1
sp|A6N6J0|CHI46_TRIHA	5.84e-18	521	895	37	390	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1
sp|O14456|CHI1_METAN	2.31e-16	513	823	29	363	Endochitinase 1 OS=Metarhizium anisopliae OX=5530 GN=chit1 PE=1 SV=1
sp|P32470|CHI1_APHAL	3.08e-16	521	773	36	302	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.001585	0.998394	CS pos: 24-25. Pr: 0.9358

TMHMM  Annotations     

There is no transmembrane helices in EPE06554.1.