CAZyme Information: EPE06320.1

Basic Information

• Species: Ophiostoma piceae
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Ophiostoma; Ophiostoma piceae
• CAZyme ID: EPE06320.1
• CAZy Family: GH3
• CAZyme Description: Glycosyltransferase family 34 protein [Source:UniProtKB/TrEMBL;Acc:S3CZE5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
458		53208.85	8.0561

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_OpiceaeUAMH11346	8884	1262450	0	8884

• Gene Location: location=KE148153:348033-349521(-)

Full Sequence      

MSLSRSPSPTPGGGWSSPGLNINGSGRSSPKAFDSNGGASHSGDFSRSRNTASSKYPSFS
TQNQGFFTRHMRQLSSSLPRFNADPAVHGAPYTEKDKPVGGSSNNLLGRIRLAYARTNKK
VKVRVLVVFALLAAIFIFYHSPLVYHWRRASWLGGGEKFVIILAANVGGGVMEWKGAREW
AIERDSTRNKKRYAERWGYDLEIVDMSTKKRYAHEWRESWEKVDFIRQAMRKYPKAEWFW
WLDLNTFVMEPSYSLQDHLFNELENNIYRDINEYNPLNISHPLNEVYLDELSLSPTGDGT
ADSVNLILSQDCSGFNLGSFFIRKSEWTDRLLDVWWDPVAYEQKHMDWEHKEQDALEQLY
TAQPWIRQHMGFLPQRMINSFPEGACSENGVNSRFHYEKTDRDFLVNMAGCEWGRDCWGE
MYNYRELSYYLNRSWWELFKEDLLCAIWFKLTGQKVKF

Enzyme Prediction     

No EC number prediction in EPE06320.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT34	157	419	4.7e-87	0.9878048780487805

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
368535	Glyco_transf_34	4.68e-81	157	417	3	238	galactosyl transferase GMA12/MNN10 family. This family contains a number of glycosyltransferase enzymes that contain a DXD motif. This family includes a number of C. elegans homologs where the DXD is replaced by DXH. Some members of this family are included in glycosyltransferase family 34.
215616	PLN03181	2.25e-04	220	335	183	266	glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAP69563.1|GT34	2.19e-241	1	457	1	460
CDP23580.1|GT34	2.19e-241	1	457	1	460
VBB72694.1|GT34	2.19e-241	1	457	1	460
AEO65857.1|GT34	3.60e-232	1	458	1	457
UQC79993.1|GT34	2.92e-229	1	457	335	790

PDB Hits     

EPE06320.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P50108|MNN10_YEAST	2.53e-104	148	439	109	390	Probable alpha-1,6-mannosyltransferase MNN10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNN10 PE=1 SV=1
sp|P78817|YFE6_SCHPO	3.88e-85	157	438	73	343	Uncharacterized alpha-1,2-galactosyltransferase C637.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC637.06 PE=2 SV=2
sp|O94622|YBKD_SCHPO	6.49e-25	184	411	125	333	Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1289.13c PE=3 SV=1
sp|Q09174|GMA12_SCHPO	2.24e-24	188	427	129	349	Alpha-1,2-galactosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gma12 PE=1 SV=1
sp|Q10359|GMH3_SCHPO	5.87e-20	189	411	114	314	Alpha-1,2-galactosyltransferase gmh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gmh3 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000065	0.000000

TMHMM  Annotations     

Start	End
125	147