CAZyme Information: EPE06072.1

Basic Information

• Species: Ophiostoma piceae
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Ophiostoma; Ophiostoma piceae
• CAZyme ID: EPE06072.1
• CAZy Family: GH28
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:S3BZW8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
379	KE148154|CGC7	41696.53	4.3835

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_OpiceaeUAMH11346	8884	1262450	0	8884

• Gene Location: location=KE148154:506437-507647(+)

Full Sequence      

MTSFYPVARPMLSRLVVGLLLLGLVHRAWADCECGYSAVIDDDTPLFTDLIETDFAHLDD
IATNTDWVRQAFNVTADKARGSYGEMYQADNMRTAVSTNAKTEDGQAKNGQPAGLELVVN
PRLVNGMVPAAEIDSSRTDVLFGTFRASMRLTNVAGTCSAFFWYFNDTQEIDMEFLSREY
NTTNSTYPVNLVLQSREAAESGFDAAGTPTFVKANLPFDPTANFHEYRIDFLPGKVVFYA
DNEVLAEMGSDAVPTHAGHLVMQQWSNGNPQWSGGPPTQDATTTVAYVKAYFNSSSSQRQ
SDWAHRCRDMNAPGAVCPIPEMTATNSTPSEWFFTNQGNMTNNQTVSGQDSAGTSVSVMD
NLWLMLIVSLLVAGRVRVW

Enzyme Prediction     

No EC number prediction in EPE06072.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	105	291	2.7e-86	0.96875

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185683	Glyco_hydrolase_16	1.35e-40	112	291	37	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	1.11e-12	135	289	26	168	Glycosyl hydrolases family 16.
185684	GH16_lichenase	5.75e-10	142	287	68	205	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
185685	GH16_XET	1.41e-07	136	242	42	141	Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling.
178706	PLN03161	3.65e-06	136	242	63	161	Probable xyloglucan endotransglucosylase/hydrolase protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ62950.1|GH16_23	1.11e-130	16	374	32	390
VBB86764.1|GH16_23	1.74e-129	21	346	34	367
CDP32289.1|GH16_23	2.47e-129	21	346	34	367
AEO58087.1|GH16_23	3.27e-128	26	355	53	401
UQC77992.1|GH16_23	1.02e-122	30	353	21	335

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3D6E_A	2.98e-06	142	274	59	181	Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis],3D6E_B Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis]

Swiss-Prot Hits     

EPE06072.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000217	0.999735	CS pos: 30-31. Pr: 0.9741

TMHMM  Annotations     

There is no transmembrane helices in EPE06072.1.