CAZyme Information: EPE05896.1

Basic Information

• Species: Ophiostoma piceae
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Ophiostoma; Ophiostoma piceae
• CAZyme ID: EPE05896.1
• CAZy Family: PL26
• CAZyme Description: Chitinase [Source:UniProtKB/TrEMBL;Acc:S3C2C5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407	KE148155|CGC5	44806.84	4.5051

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_OpiceaeUAMH11346	8884	1262450	0	8884

• Gene Location: location=KE148155:1036833-1038056(+)

Full Sequence      

MLRLSSSIWLCIWTLLLQQCVALPAAYSISLANGTANATDDNPAPPEPVFSLPYSLPYSL
PRLVIYFQSANDPTGAPISLLPLITEKGIALTHLIISSFHINRDQDLVLNDWAPSDTRFD
TLWSEAAILQRAGVRVMGMLGGAASGAWTTDTLDSPDVDTFEHYYGQLHNLIVQHGLQGI
DLDVEQKMSQDGISRLIRRLTADFNSDYSNRFEITLAPVGSALLPHITGGNLSGFRYQTL
ELELGKEIAFYNAQLYNGWGTVESPIFYQMMLGNGSGLDPECPWVPEKVLLGDVTSPDNG
DGYVDAPIFNLTVAAIRDTYKPRHEIGGIMGWEYFNSLPGNTAKPWVWAQEMTAILRPGL
APYLNLTEDDAHQLTAAYARSVGRRVGARSLPLAEAPPINYYDMITK

Enzyme Prediction     

EC	3.2.1.96:4

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119363	GH18_CTS3_chitinase	4.46e-114	62	337	1	256	GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii. CTS3 has a chitinase-like glycosyl hydrolase family 18 (GH18) domain; and has homologs in bacteria as well as fungi.
119349	GH18_chitinase-like	4.18e-14	63	257	1	177	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119350	GH18_chitinase_D-like	3.06e-04	129	332	69	293	GH18 domain of Chitinase D (ChiD). ChiD, a chitinase found in Bacillus circulans, hydrolyzes the 1,4-beta-linkages of N-acetylglucosamine in chitin and chitodextrins. The domain architecture of ChiD includes a catalytic glycosyl hydrolase family 18 (GH18) domain, a chitin-binding domain, and a fibronectin type III domain. The chitin-binding and fibronectin type III domains are located either N-terminal or C-terminal to the catalytic domain. This family includes exochitinase Chi36 from Bacillus cereus.
226000	Chi1	4.35e-04	115	332	83	302	Chitinase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAL49863.1|GH18|3.2.1.96	1.00e-111	62	405	34	357
CAL49862.1|GH18|3.2.1.96	1.42e-111	62	405	34	357
CAZ16624.1|GH18|3.2.1.96	1.42e-111	62	405	34	357
EHK47006.1|GH18|3.2.1.96	4.46e-111	62	401	36	356
UKZ96087.1|GH18	4.46e-111	62	405	36	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4AC1_X	1.09e-100	62	360	4	283	Chain X, ENDO-N-ACETYL-BETA-D-GLUCOSAMINIDASE [Trichoderma reesei]
2Y8V_A	1.48e-71	62	353	14	285	Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_B Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_C Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293],2Y8V_D Structure of chitinase, ChiC, from Aspergillus fumigatus. [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

EPE05896.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000207	0.999788	CS pos: 22-23. Pr: 0.9801

TMHMM  Annotations     

There is no transmembrane helices in EPE05896.1.