CAZyme Information: EPE05830.1

Basic Information

• Species: Ophiostoma piceae
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Ophiostoma; Ophiostoma piceae
• CAZyme ID: EPE05830.1
• CAZy Family: GH18
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:S3CY64]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
887		96376.28	4.7042

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_OpiceaeUAMH11346	8884	1262450	0	8884

• Gene Location: location=KE148155:796990-799773(+)

Full Sequence      

MADISSPSESSLLGTTPDTEISPPSSPLGTNSTKSTDNTDNKPLDSARQIAKNKLAALTL
EEKVSLLTAADFWRTKAIPAKGVPAAKTTDGPNGARGGIFVGGTKAALFPCGISLAATWN
KSLLYSVGQHLADEVKARSADILLGPTVCMHRHPLGGRNFESFSEDPLLTGKLAAQYILG
LQQKGVGAAIKHFVGNEQETNRNTIDSRVSERPLREIYLRPFEIAIRESSPWAVMSSYNL
VNGVHADMNRHILQDILRGEWGYDGTVISDWDGINSTVESIQAGCDIEFPYSTKWRFEKA
VRAVEDGTLSIEDVDRAAENALLLVSRAKGDDMSEELPEREDDRTKTRALIRDAGVQGLT
LLKNEGSILPLDAKTTTIAVIGPNANRAIAGGGGSASLNPYYTTLPLESIRQAVADAGGL
PENISYAVGCHINKWLPVASPFCSTSTTKETPGVTIDWFAGDQFGVPVLTQTRTNTDLFL
WDSAPLAQVGPEWSAIATTYLTPTSTGRHTISFMSVGPGRLFVDGKQILDLWDWTEEGEA
MFDGSVDYLVEVDMQAGVAVELQVRMTNELRPASKQKQFNTTHRYGGCRIGFKEQDRVDY
LEQAVAAAGAADVAVVVVGVDAEWESEGYDRQTMDLPLDGSQDRLIEAVLAVNPNTVVIN
QSGSPVSMPWADKVPAIMQAWYQGQEAGNALADVLFGKANPSGKLPCTFPRRLQDTPAYH
NWPGENLEVVYGEGLYIGYRHYERASIPPLFAFGHGLSYTTFEYGRPSISRKVLGDAPGE
TVDITLAVSNIGSVGGAETVQVYVHDEKSRLPRPEKELAAFEKVFLDAGETKHIQIPLDK
YAVGYYDTAIGRWIAEQGRFDVLIGSSSADIRRSISFEVEESFTWVV

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	77	289	6.3e-69	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.63e-80	109	878	120	763	beta-glucosidase BglX.
224389	BglX	8.90e-76	71	424	48	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.27e-52	359	739	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
178629	PLN03080	1.32e-46	51	839	53	743	Probable beta-xylosidase; Provisional
395747	Glyco_hydro_3	3.90e-40	82	324	65	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO53892.1|GH3	0.0	6	886	21	883
AEO66128.1|GH3	0.0	6	886	21	887
VBB72333.1|GH3	0.0	16	886	36	907
CDP23238.1|GH3	0.0	16	872	36	895
CAP69216.1|GH3	0.0	16	872	36	895

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.09e-178	55	885	10	842	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.28e-174	55	885	10	842	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	2.72e-155	52	871	6	660	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	2.03e-127	58	871	12	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.44e-113	55	881	8	715	Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	4.26e-221	55	880	15	839	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|P27034|BGLS_RHIRD	1.85e-203	55	879	6	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
sp|A1DNN8|BGLJ_NEOFI	5.44e-200	44	862	7	838	Probable beta-glucosidase J OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglJ PE=3 SV=1
sp|A1CA51|BGLI_ASPCL	6.06e-198	55	886	10	836	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
sp|Q2U8Y5|BGLI_ASPOR	2.48e-197	58	886	13	837	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000036	0.000006

TMHMM  Annotations     

There is no transmembrane helices in EPE05830.1.