CAZyme Information: EPE04734.1

Basic Information

• Species: Ophiostoma piceae
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Ophiostoma; Ophiostoma piceae
• CAZyme ID: EPE04734.1
• CAZy Family: GH13
• CAZyme Description: Glycosyl transferase family 17 protein [Source:UniProtKB/TrEMBL;Acc:S3BU26]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
404		45722.81	6.6641

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_OpiceaeUAMH11346	8884	1262450	0	8884

• Gene Location: location=KE148159:467020-468234(+)

Full Sequence      

MRLMLPLGPARALRTYVIVLAVLAVTWFTWSGTVATVPHPIGAVHDGAVGEQGKSAYAVC
AAHGWRPFSLPTSAARPRRVYDLIMVNDELDWLEVRLNTTFDDVDYYVIVEAPLTFTGLD
KPLTIRDNWQKFAPYHAKMLYHQLQYPPNFNPPRAWDREDLQRDAMMLQVLAPGAVPTGT
DPSAQVDLDTVTPQHGDVLVVADVDEIPRPDTLRALRLCEFPRRLTLASQFYYYSFQFRH
RGPEWQHPQATFYDGPGNTILPVHLRNGDGGRGLSFGKGGSLVSKLFGVLSAPVTALLRS
HDKAEMPNAGWHCSSCYATMAELMHKLESVSHTWMNQDYFRNPERAAHHVRLGLDLWDRE
SEVYDRIDGNKDLPQYLLTQPERFRYLLNRDGNSAGFSDYPSQN

Enzyme Prediction     

No EC number prediction in EPE04734.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT17	58	388	2.3e-78	0.9788732394366197

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
398414	Glyco_transf_17	1.48e-41	52	388	53	342	Glycosyltransferase family 17. This family represents beta-1,4-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase (EC:2.4.1.144). This enzyme transfers the bisecting GlcNAc to the core mannose of complex N-glycans. The addition of this residue is regulated during development and has functional consequences for receptor signalling, cell adhesion, and tumor progression.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ55398.1|GT17	6.27e-140	7	401	1	368
UPK94287.1|GT17	3.39e-124	45	401	59	377
AEO53918.1|GT17	5.46e-123	51	399	43	354
ANH56577.1|GT17	7.54e-123	54	403	65	376
ANH56575.1|GT17	1.56e-122	51	403	64	377

PDB Hits     

EPE04734.1 has no PDB hit.

Swiss-Prot Hits     

EPE04734.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.494119	0.505880	CS pos: 35-36. Pr: 0.4125

TMHMM  Annotations     

Start	End
12	34