CAZyme Information: EPE04732.1

Basic Information

• Species: Ophiostoma piceae
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Ophiostoma; Ophiostoma piceae
• CAZyme ID: EPE04732.1
• CAZy Family: GH13
• CAZyme Description: Trehalase [Source:UniProtKB/TrEMBL;Acc:S3BW30]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
715	KE148159|CGC2	78576.84	4.6512

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_OpiceaeUAMH11346	8884	1262450	0	8884

• Gene Location: location=KE148159:460322-462520(-)

Full Sequence      

MPAMPASGLASRGIAASFSRTASAIAAVALVLCAGPAAAVFNNGSIIAPCSSPLYCYGDI
LKSIELAAPFSDSKTFVDMPTVRPLDEVVAAFNNLTKPISNNTELNDFLSTYFAPAGGEL
ESVPADQLTTNATFLAKLNDTVIHQFVQKVIGIWPDLTRQYTGSAGDSGCDGCESSFVPV
NRSFVVAGGRFREPYYWDSYWIIEGLLRTGGSFVTISRNIIENFLDLIEEFGFVPNGARI
YYLNRSQPPLLSQMVRVYLEHTNDLSILERALPILIKEHEFWTVNRSVSVTAPSNKTYTL
NHYSVANNQPRPESFLEDYVTANNQSYYASNGSVYPETAPFNETEQQALYAQLASGAESG
WDYSARWLARPNDSASGTYFPLRSLNINNLLPVDLNSILYWNEVTIGGFLEFTGNSTAAR
QWGKAASQRSEAMHELMWNETLFSYFDYNLTSKAQDIFVPRDNTSSIADTANAPEGYQVL
FNVAQLYPFWTGAAPAQLKNNPLAVKQAYSHVEAYLDNYLGGIPATNLQTGQQWDTPNVW
PPLQHILIQGLLNTPATFGPQDTDYEDLQKLALRLAQRYLDSSFCTWYATGGSTSETPQL
AGFTSADNGTMFEKYTYNSTNGAGGGGEYTVVEGFGWTNGVLIWAADTFSGKLVRPECGN
ITAAQITPGKRKRNDVLALERRDEVADITGRRARPPSAVQLDPYDATFIKKFGRG

Enzyme Prediction     

EC	3.2.1.28:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH37	70	647	1.3e-156	0.9918533604887984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395961	Trehalase	1.77e-138	70	643	3	502	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
215307	PLN02567	4.76e-132	68	647	25	549	alpha,alpha-trehalase
224541	TreA	1.05e-85	52	643	53	546	Neutral trehalase [Carbohydrate transport and metabolism].
183936	treA	2.87e-76	1	652	1	539	alpha,alpha-trehalase TreA.
237326	treA	1.24e-72	24	665	19	550	alpha,alpha-trehalase TreA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEO70020.1|GH37	0.0	23	714	5	678
EAA35900.1|GH37	0.0	37	714	20	675
ATY63688.1|GH37	0.0	16	714	2	670
AEO53147.1|GH37	0.0	26	714	7	677
QBZ56021.1|GH37	0.0	26	713	9	677

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7E9U_A	6.30e-74	72	643	40	548	Chain A, Trehalase [Arabidopsis thaliana],7E9U_B Chain B, Trehalase [Arabidopsis thaliana]
7E9X_A	8.85e-73	72	643	40	548	Chain A, Trehalase [Arabidopsis thaliana],7E9X_B Chain B, Trehalase [Arabidopsis thaliana],7E9X_C Chain C, Trehalase [Arabidopsis thaliana],7E9X_D Chain D, Trehalase [Arabidopsis thaliana],7EAW_A Chain A, Trehalase [Arabidopsis thaliana],7EAW_B Chain B, Trehalase [Arabidopsis thaliana]
2JG0_A	1.84e-62	58	667	15	518	Family 37 trehalase from Escherichia coli in complex with 1- thiatrehazolin [Escherichia coli K-12],2JJB_A Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_B Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_C Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2JJB_D Family 37 trehalase from Escherichia coli in complex with casuarine-6- O-alpha-glucopyranose [Escherichia coli K-12],2WYN_A Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_B Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_C Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12],2WYN_D Structure of family 37 trehalase from Escherichia coli in complex with a casuarine-6-O-a-D-glucoside analogue [Escherichia coli K-12]
5Z66_A	4.62e-62	51	647	45	537	Structure of periplasmic trehalase from Diamondback moth gut bacteria complexed with validoxylamine [Enterobacter cloacae],5Z6H_A Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae],5Z6H_B Structure of periplasmic trehalase from Diamondback moth gut bacteria in the apo form [Enterobacter cloacae]
2JF4_A	1.68e-59	58	667	15	518	Family 37 trehalase from Escherichia coli in complex with validoxylamine [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54QZ5|TREA_DICDI	3.64e-121	50	658	49	594	Trehalase OS=Dictyostelium discoideum OX=44689 GN=treh PE=3 SV=1
sp|Q8MMG9|TREA_PIMHY	5.02e-106	50	642	45	564	Trehalase OS=Pimpla hypochondriaca OX=135724 GN=tre1 PE=1 SV=1
sp|Q9JLT2|TREA_MOUSE	1.52e-105	49	653	24	551	Trehalase OS=Mus musculus OX=10090 GN=Treh PE=1 SV=1
sp|O43280|TREA_HUMAN	5.92e-103	49	653	27	554	Trehalase OS=Homo sapiens OX=9606 GN=TREH PE=1 SV=2
sp|P19813|TREA_RABIT	7.24e-103	49	653	27	553	Trehalase OS=Oryctolagus cuniculus OX=9986 GN=TREH PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.012241	0.987756	CS pos: 39-40. Pr: 0.9246

TMHMM  Annotations     

There is no transmembrane helices in EPE04732.1.