CAZyme Information: EPE04409.1

Basic Information

• Species: Ophiostoma piceae
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Ophiostoma; Ophiostoma piceae
• CAZyme ID: EPE04409.1
• CAZy Family: GH125
• CAZyme Description: Pectate lyase [Source:UniProtKB/TrEMBL;Acc:S3BT14]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
253	KE148161|CGC5	26123.77	8.1590

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_OpiceaeUAMH11346	8884	1262450	0	8884

• Gene Location: location=KE148161:439585-440346(+)

Full Sequence      

MKYSAVLSALFATALAIPSTGVTPNTVGVLDRRATFPIPASKGSVTYPSSKTISGVFDGG
LKTYGRGVSCTGQAEGTDKDAVFILEDGATLKNAIIGTDQIEGVHCKGSCTIINVWWKAV
CEDALTLKGNGDATITGGGATGAEDKVIQHNGLGTVTIDGFTVVDFGKLYRSCGNCKVMG
ERNVVVKNVKAYNGKLLVGINSNKGDVAKITGSCATSVKKICSEFEGTTPGNEPKLIRSG
PSDHCVYSSVAAC

Enzyme Prediction     

EC	4.2.2.2:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	42	227	2.9e-75	0.9896907216494846

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	7.66e-111	35	232	1	200	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK92346.1|PL3_2	1.06e-145	1	253	1	254
CZS77943.1|PL3_2	5.86e-143	1	253	1	254
QGI96076.1|PL3_2	5.86e-143	1	253	1	254
QPC67983.1|PL3_2	5.86e-143	1	253	1	254
CCT69159.1|PL3_2	5.86e-143	1	253	1	254

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	2.78e-28	44	232	8	188	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
3B90_A	3.22e-26	66	231	12	200	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B90_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
3B4N_A	2.83e-25	66	231	130	318	Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B4N_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_A Chain A, Endo-pectate lyase [Dickeya chrysanthemi],3B8Y_B Chain B, Endo-pectate lyase [Dickeya chrysanthemi]
4EW9_A	7.09e-23	57	191	22	158	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	7.26e-23	57	191	23	159	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1DBJ7|PLYE_NEOFI	6.57e-105	7	247	8	247	Probable pectate lyase E OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyE PE=3 SV=1
sp|Q5B7Z3|PLYE_EMENI	3.09e-103	30	248	28	248	Pectate lyase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyE PE=1 SV=1
sp|B0Y9M8|PLYE_ASPFC	1.77e-102	7	253	8	254	Probable pectate lyase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyE PE=3 SV=1
sp|Q4WC29|PLYE_ASPFU	1.77e-102	7	253	8	254	Probable pectate lyase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyE PE=3 SV=1
sp|A1C4B8|PLYE_ASPCL	4.13e-101	1	248	1	248	Probable pectate lyase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=plyE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000398	0.999574	CS pos: 33-34. Pr: 0.4534

TMHMM  Annotations     

There is no transmembrane helices in EPE04409.1.