CAZyme Information: EPE04099.1

Basic Information

• Species: Ophiostoma piceae
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Ophiostoma; Ophiostoma piceae
• CAZyme ID: EPE04099.1
• CAZy Family: CE16
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:S3BS20]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
834		89143.37	5.2837

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_OpiceaeUAMH11346	8884	1262450	0	8884

• Gene Location: location=KE148162:10193-12845(-)

Full Sequence      

MSKTDLNAVLATLTLEEKVSLLAGANFWETVQIPSKGIPPLKVSDGPNGARGGTFSGGIT
SACFPAACSVASTFDVDIARRIGVALGEETYTKGARVVLAPTVCMHRHPLGGRNFESFSE
DPFLAGKLAARVVDGVQSTGVSATIKHFVANEQETQRLTVDTDVSARALREIYLKPFEIA
VKEANPGAIMTAYNLINGTHADSNALLHDVLRGDWGWEGLVMSDWGGVNSTVDALEAGLD
LEMPGPTQWRKVEAVVAAVHAGKLSAKTIDERALRVLRFLERQRCFEDPTIPDEKAVNKP
EHQALIREAGSKGIVLLKNDNSILPLSKEKLKGKKVALLGYAKDCLAHGGGSAAVNAHYK
ITPFEALQSALGNDVELTYAKGAPTFRQLPLLLENVVGLDGSTGFTYKIYVPGNAEPIKT
INGHKSEVSLLQAVYQETNEAELTGTFTPTETATYYFTLSGLGPSLLLVDGKVAYEQEGN
CKDFMGFLLGGVAVPLIKLPLQAGTPYKLQVRSVPPKPVEGEDIIPLFLDLPGVRLGVMS
ATEHDKDILPEAVELAKVADVAIVFTGHEPDWETEGQDQLSFNLPKDGSQDRLVEAVAAA
NPNTIVVNSTGVAVAMPWLGEIQALVQSWFPGQEAGNAIADVLTGARNPEGHLTCTFPKR
VEDSPAYGNFPGTHVDGKLKVTYAEGVFIGYRHYDRLPADKVSFPFGFGLSYTTFSFSHL
AVSAASADEYGVKVTVSNTGTVKGATAVQIYVGSSVPTSENPIKALASFKKVTLQPGESA
AVELVVKLQDIASWDEKGHQWVIKAGDYTFSVGKNAQDLVLSTDVAIAAKTYLP

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	32	244	3.6e-65	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.20e-75	64	818	120	756	beta-glucosidase BglX.
224389	BglX	3.68e-68	27	344	49	366	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	1.01e-48	314	691	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
395747	Glyco_hydro_3	1.40e-40	40	278	67	315	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	2.65e-39	8	813	55	769	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UPK99435.1|GH3	0.0	1	832	1	832
CEF72767.1|GH3	0.0	1	834	1	834
CZS76034.1|GH3	0.0	1	834	1	834
QPC75250.1|GH3	0.0	1	834	1	834
CCT62926.1|GH3	0.0	1	834	1	836

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3AC0_A	1.69e-178	1	832	1	841	Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	2.81e-173	2	832	2	841	Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
7MS2_A	4.64e-121	5	827	4	668	Chain A, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	3.19e-114	13	819	12	655	Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	4.04e-104	9	827	57	828	Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BFG8|BGLB_EMENI	0.0	5	834	10	845	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
sp|Q2U8Y5|BGLI_ASPOR	7.97e-190	1	823	1	827	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
sp|B8NDE2|BGLI_ASPFN	6.30e-189	1	823	1	827	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
sp|A1DFA8|BGLI_NEOFI	3.42e-188	1	832	1	834	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
sp|B0Y3M6|BGLI_ASPFC	9.62e-188	1	823	1	826	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.757507	0.242496

TMHMM  Annotations     

There is no transmembrane helices in EPE04099.1.