CAZyme Information: EPE04096.1

Basic Information

• Species: Ophiostoma piceae
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Ophiostoma; Ophiostoma piceae
• CAZyme ID: EPE04096.1
• CAZy Family: CE16
• CAZyme Description: Bac_rhamnosid6H domain-containing protein [Source:UniProtKB/TrEMBL;Acc:S3BXA8]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
758	KE148162|CGC4	83936.58	5.5025

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_OpiceaeUAMH11346	8884	1262450	0	8884

• Gene Location: location=KE148162:3353-5687(-)

Full Sequence      

MGKKDDTRLIVIPFPWIEPNSSSVSSVSLFSFLSLSAFVLRSPYCAYITSLVVVSSLPPF
PPPRNIAAMVKNEDEIVASFPQTVFEASPSSEDAPWQSYNFAPKSRTVKADSIYTTEGNV
SSPPQTQLGDVASVTLTGSSALVTVDFGVNTAGIVTLRFGPQSVPQTAVGIAFAESKQFI
GRGSDRSMDFHVIDGALHIVVPDKTADQSWTCPEPQQRGAFRYLTLYLESDGQVELTEIT
TYNNMLPSFGDNLRAYPGYFYSSDDFLNTIWYAGAYTLQIATIPRDTGRRSDWVHRKTGW
ANDIQAAPQKYIEVLTDGARRDRTVWSGDRNISTVTNFIALNGKEGTWAGVDWMFELQTD
EGLFPYACKPIWHYGSDSYHVWTFIALYEAYFYHADGSEKDKDWIREKWGKVIKGMDLAL
SKIDETGLLKVTLPADWGRNQLIGHNMEVNACLHYVLRQFSQLAQDVAGDTALSKAWAKQ
AALVKDAINTHLWDEEAGLYRDYIDAPVHPQDGNTLSLWYDVVSSPERAARVSQGLTANW
SKFGPVAPESPQMVSSFCSSMELVAHNIAGRPDRALTVLRTMWGYIWNSPYAVQSSLIEG
YYHDGRCFYPFGEYDAAYISHAHPWASGPTIALSFWLVGLRLLGVGHERWIFAPQLSLEA
GEEGKGNSPEWALTGFTSNAQGFFSAGYKQSSPTELVLAIKAPESTTGRVGLPTLGKAII
KVEQDGVKLDLSSLKLENAHLFVNDVKGGKRTFIIAYK

Enzyme Prediction     

No EC number prediction in EPE04096.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	142	710	8.9e-66	0.9801587301587301

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	1.12e-13	258	538	4	253	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
395961	Trehalase	2.21e-07	463	544	320	403	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
224541	TreA	2.83e-05	467	532	373	441	Neutral trehalase [Carbohydrate transport and metabolism].
183934	treF	1.99e-04	469	503	370	404	alpha,alpha-trehalase TreF.
225990	COG3459	4.23e-04	412	531	717	849	Cellobiose phosphorylase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG87565.2|GH78	2.71e-203	77	758	1	660
QRV95788.1|GH78	1.23e-182	79	717	19	661
QRW10072.1|GH78	4.40e-180	79	715	19	659
QRV81298.1|GH78	6.21e-180	79	715	19	659
ANZ74941.1|GH78	3.43e-176	79	744	2	650

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.86e-10	146	656	197	655	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

EPE04096.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999916	0.000070

TMHMM  Annotations     

There is no transmembrane helices in EPE04096.1.