CAZyme Information: EPE03474.1

Basic Information

• Species: Ophiostoma piceae
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Ophiostoma; Ophiostoma piceae
• CAZyme ID: EPE03474.1
• CAZy Family: AA7
• CAZyme Description: S-formylglutathione hydrolase [Source:UniProtKB/TrEMBL;Acc:S3BQ57]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
302		32436.59	6.4213

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_OpiceaeUAMH11346	8884	1262450	0	8884

• Gene Location: location=KE148167:125002-125910(-)

Full Sequence      

MAFTTKATITTFGGRLLKLVHQSAVTGTEMAVNVFLPGAKAPSATKFPVLYYLSGLTCSP
ENCSEKGFVHAAAAKHGIAVVYPDTSPRGLDLPAEHDAYDFGSAASFYIDADAATPYGKN
YRMETYITKELPALLFKEFADLDASRQSITGHSMGGHGALTLYLKNPGQYKSVSAFAPIS
NPTLCPWGQKAFKGYLGPADSDITPESAAADPSAVPAAWKAHDATELVKTWSGDLKMLID
VGTGDNFYVAKQLLPENFAQAVKDAGLAGLTLRYQDAYDHSYYFISSFSQDHVDHAAKHL
FA

Enzyme Prediction     

No EC number prediction in EPE03474.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	23	297	3.2e-49	0.9823788546255506

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178061	PLN02442	1.04e-117	12	300	14	281	S-formylglutathione hydrolase
131868	fghA_ester_D	1.28e-106	12	300	9	275	S-formylglutathione hydrolase. This model describes a protein family from bacteria, yeast, and human, with a conserved critical role in formaldehyde detoxification as S-formylglutathione hydrolase (EC 3.1.2.12). Members in eukaryotes such as the human protein are better known as esterase D (EC 3.1.1.1), an enzyme with broad specificity, although S-formylglutathione hydrolase has now been demonstrated as well. [Cellular processes, Detoxification]
223700	FrmB	6.76e-76	11	300	15	312	S-formylglutathione hydrolase FrmB [Defense mechanisms].
395613	Esterase	3.48e-49	23	295	1	246	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYF76555.1|CE1	1.65e-12	15	244	73	280
BAW03422.1|CE1	2.35e-11	15	244	48	255
APA94867.1|CE1	2.35e-11	15	244	48	255
BAW03424.1|CE1	4.14e-11	22	233	60	250
AKK09883.1|CE1	5.35e-11	23	184	64	208

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FCX_A	2.48e-85	12	300	12	280	Chain A, S-formylglutathione hydrolase [Homo sapiens],3FCX_B Chain B, S-formylglutathione hydrolase [Homo sapiens]
6JZL_A	2.17e-72	12	300	12	277	S-formylglutathione hydrolase homolog from a psychrophilic bacterium of Shewanella frigidimarina [Shewanella frigidimarina],6JZL_B S-formylglutathione hydrolase homolog from a psychrophilic bacterium of Shewanella frigidimarina [Shewanella frigidimarina]
3S8Y_A	1.63e-69	12	300	13	278	Bromide soaked structure of an esterase from the oil-degrading bacterium Oleispira antarctica [Oleispira antarctica]
3I6Y_A	1.18e-66	12	300	13	278	Structure of an esterase from the oil-degrading bacterium Oleispira antarctica [Oleispira antarctica],3I6Y_B Structure of an esterase from the oil-degrading bacterium Oleispira antarctica [Oleispira antarctica]
1PV1_A	2.08e-66	13	300	11	296	Crystal Structure Analysis of Yeast Hypothetical Protein: YJG8_YEAST [Saccharomyces cerevisiae],1PV1_B Crystal Structure Analysis of Yeast Hypothetical Protein: YJG8_YEAST [Saccharomyces cerevisiae],1PV1_C Crystal Structure Analysis of Yeast Hypothetical Protein: YJG8_YEAST [Saccharomyces cerevisiae],1PV1_D Crystal Structure Analysis of Yeast Hypothetical Protein: YJG8_YEAST [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P10768|ESTD_HUMAN	6.36e-85	12	300	12	280	S-formylglutathione hydrolase OS=Homo sapiens OX=9606 GN=ESD PE=1 SV=2
sp|Q9GJT2|ESTD_PIG	2.56e-84	12	300	12	280	S-formylglutathione hydrolase OS=Sus scrofa OX=9823 GN=ESD PE=2 SV=1
sp|B0BNE5|ESTD_RAT	2.07e-83	12	300	12	280	S-formylglutathione hydrolase OS=Rattus norvegicus OX=10116 GN=Esd PE=2 SV=1
sp|Q9R0P3|ESTD_MOUSE	1.18e-82	12	300	12	280	S-formylglutathione hydrolase OS=Mus musculus OX=10090 GN=Esd PE=1 SV=1
sp|Q08E20|ESTD_BOVIN	6.71e-82	12	300	12	280	S-formylglutathione hydrolase OS=Bos taurus OX=9913 GN=ESD PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EPE03474.1.