CAZyme Information: EPE03379.1

Basic Information

• Species: Ophiostoma piceae
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Ophiostoma; Ophiostoma piceae
• CAZyme ID: EPE03379.1
• CAZy Family: AA7
• CAZyme Description: Udp-glucose glycoprotein glucosyltransferase [Source:UniProtKB/TrEMBL;Acc:S3BPX0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1525	KE148168|CGC1	169112.07	4.7895

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_OpiceaeUAMH11346	8884	1262450	0	8884

• Gene Location: location=KE148168:219151-223796(-)

Full Sequence      

MAGFPNRPRGLAMALLAALSLQPSLTAASPSVDVGMIAAFPAPPYLTELLETAAQENATS
YYPILDRIAEGYFADASTDRDLYEKFLALLKDGGHVASDAALSTFKLALSLRSAAPRVEA
HYQFYNTAAEGSVSGDQTGCSQWILWEGSQYCSPSLDEAHSKVSGHQRQEKTVPFDNTLS
HGPAAILYADITSPGFGPFHKFLAEKARNGEISYRLRHVRPTAVDGVAEPLPVNGYGVEL
ALKRTDYIVIDDRESATGNEAAQKKLAAPAEVILDGEEEVTDLKALSKSELSNLGMSTAD
YIIQSENPFDTLLKVTQDFPKYSSSIAAHNASEAFLTEHQKNRALMVPPGVNVMWMNGVQ
LIERQIQPLALLDIVRRERIMIDGVCELGLTGKEAVDILGHQAVAQSKAESAPLRFDWRD
EIEDGRVIIWLNDLVNDNMYEEYPKTLRALLQGGMPGQIPPIGLDVFNQLYPVDLTKKAD
IHLIVNQLVDFVRRRLPVRFGLVPLTPTPEAAKQAKVVYYLLETHGLIAVVGYLTQTLKD
GKAASPNASIFKSIVKDHDLREEAKVLAFDDIMTDEGYAKQIELAQHWADRLGANSEIPP
IFIDGSVVPRDERWVQTMSNQVALNLRAIQEAIYYKRIDDTIWAPDFFLIESLTRRNALI
FPEGPQSLHVLNVHKLLTEHADLFNHIPSIEADEETTKETWAALTVVLDIGTEDGLKLLI
NALQFRVNNPGVTLDVVYNPKDTDSALDLINSLQDVDLDVLTEVQSWEELKALIATEKPA
TADYLAALTRFRTAAAINPGDNMLILNGRVLGPVDKADSFKEDDFFTFLEYEQAERILPV
YKAVEDLNMTSKVSSPIGAAKLTSITALSTITDVPEGIFESAPTLRISSFNLWTAEHTAF
EAGDAATATIHFNIALDPASEVGQRWTPILKVLSQLDGVYMRVFLNPRDRLQDFPVKRFY
RSVLEAAPLFDDAGKVKALAARFNGLPSEALLNLGMEVPPAWLVAPKVSVQDLDNIKLSS
VKSDITATYELEHILIEGHSEEEGSKAPRGAQLILGTEKDEHFADTIIMANLGYFQFKAN
PGFYNIKLMDGRSSDIYTIKSVGSRGKAPVPGDEGTDVVLMDFQGTTLYPRLARKPGMEK
EEIIPSDASAAPAAAARDSSAGSGGAMDYVSKGLKFAEDMIGKAKSATHKTAAVAAKEKQ
ADINIFSVASGHLYERMLNIMMVSVMENTNHTVKFWFIEQFLSPSFKDFIPSLAEAYGFE
YEMVTYKWPHWLRQQKEKQREIWGYKILFLDVLFPLSLDKVIFVDADQIVRTDMYDLVQV
DLQGAPYGFTPMCDSRTEMEGFRFWKQGYWSNYLRGQPYHISALYVVDLRRFREMAAGDR
LRQTYHTLSADPNSLSNLDQDLPNHMQFQIPIFSLPQDWLWCETWCSDEALTTAKTIDLC
NNPQTKEPKLDRARRQVPEWNVYDTAIAAIDKQRKQGSDAASKPSSPIRVGGGAGGQQKP
VVGSEPKEVAEEAVVVAGTHERDEL

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1203	1450	8.5e-135	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133054	GT8_HUGT1_C_like	0.0	1203	1450	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
408203	Glyco_transf_24	0.0	1203	1470	1	268	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
408201	Thioredoxin_14	5.38e-91	416	660	1	248	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408199	Thioredoxin_12	2.00e-67	42	225	1	183	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
408202	Thioredoxin_15	1.00e-65	672	867	1	204	Thioredoxin-like domain. This is the fourth TRXL(thioredoxin-like) domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBZ60625.1|GT24	0.0	8	1486	8	1487
UQC87132.1|GT24	0.0	1	1525	61	1551
AEO67685.1|GT24	0.0	8	1470	8	1465
VBB81405.1|GT24	0.0	11	1479	9	1468
CDP29610.1|GT24	0.0	11	1483	9	1472

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MU1_A	0.0	27	1476	6	1453	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	0.0	27	1476	6	1453	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	0.0	27	1476	6	1453	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS2_A	0.0	27	1476	6	1219	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TS8_A	0.0	29	1412	1	1382	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS8_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09140|UGGG_SCHPO	1.93e-265	28	1479	18	1433	UDP-glucose:glycoprotein glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpt1 PE=1 SV=2
sp|Q09332|UGGG_DROME	3.40e-223	44	1485	42	1522	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q0WL80|UGGG_ARATH	5.46e-216	31	1464	32	1562	UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1
sp|Q9NYU2|UGGG1_HUMAN	1.99e-206	13	1491	28	1548	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q9NYU1|UGGG2_HUMAN	1.17e-205	27	1467	30	1495	UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=UGGT2 PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000366	0.999629	CS pos: 28-29. Pr: 0.9570

TMHMM  Annotations     

There is no transmembrane helices in EPE03379.1.