CAZyme Information: EPE02655.1

Basic Information

• Species: Ophiostoma piceae
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Ophiostoma; Ophiostoma piceae
• CAZyme ID: EPE02655.1
• CAZy Family: AA2
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1425		158553.28	6.6697

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_OpiceaeUAMH11346	8884	1262450	0	8884

• Gene Location: location=KE148175:78627-83401(-)

Full Sequence      

MAGSLSRLLLLAAALAQGSLGATIHTRDNAIDSSSVDVTWLSGSPPSLQLGTSFGVPWPR
GAHQPNETEFSIAGDGGALGLQTWITGYWADGSIKWTGHAIPGTDASAAKYTIVAQKSAK
TGNTGKRSLAQTKLVVSDAKREVTVNTGKITAVFPKSGAALVKEIRTAAGKVVGQNGRLV
LQSQSGLLEEFDSPRLVDFYKFQSSIHNVSVSKDSVSRVVVTVKGSHTTFKASKKHQDWL
PFTVRFYLYENADAIRIVHSLVFDGTPDKDFISGLGVQFDVPLEGEELYNRHVRIAGVDD
GLLNEAVQGITGLRRDPGETVRQAQYQGQETPDVSTWDTRVSSRLQWIPTWNDFRLSQHS
PDGFTLAKRTKAGQSWLNIPGGTRSGGLAYLGGATKGGLAIGLRDFWKRYPNSLEVTNAA
TNLGSVIVWLYSPTASPLDLRPFHDGLGLDTYVEERDALEITYEDYEKGFNTPYGIARTS
EVYLFAFDSTPAHDTIAGLVTYIHNPPTLKVAPAYLYSSKALGSYWSLPDNSSTAAAEIE
GHLDFLFDFYKNQIDQRRWYGFLDYGDFMHTYDADRHIWRYDIGGYAWDNSELSPDLFFW
LYYLRTGREDAYRFAEALTRHTGEVDVYHIGNWKGLGTRHGVQHFSDSSKQARISQPQYR
KYFFFISGGDERVGELLEETLDTETAYGYVDPNRKVRTDGWLPAPGKPVSLGLGTDWSSL
AASWLIEWERRGSRWIEARDKLTNTASGIAKLKNGFITGTGLWDPVAKTLTAPPADLNNT
GLVAVSHLNAVFGLVEVISDALDYWGAGNQPVGFKEAWLDYAYYYDTSDKEKIQRYGATW
KSSLKQGHSRLAAFAAKNRNGTQTAARAWAAFFGDGLTNASSWRTEHISGSAVLIPVDEA
AWFATNDAAQYGLAAIQNLEYIKKYLIQWQLLARILVPAIRHLSSTTTNLDGAVHDNTFY
DDNLALPIRISIPVLSFVPASPLSFHRPRQPSSWPLPSVCNHHVVIRSTTRPLDRAVALM
VPETRILLLFMLFCAYATTNSTVLDGGTGFLKVGYAAQNFPEFQYPSIVGRPILRTEEKG
DNDLVIKDIMCGDEAAAARTMLQISYPMENGIVKKWDDMQHLWDYTFYEKMKVDTTGRKI
LLTEPPMNPLKNREQMCEVMFERYNFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIV
PVYESVVLNHLTRRLDVAGRDVTQNLIALLLRRGYALNRTADFETVRQIKEKLCYVSYDL
ELDKRLSEETTVLVESYTLPDGRVIRVGSERFEAPECLFQPHLVDCEQPGMAEFLFNTIQ
QADVDVRSSLFKAIVLSGGSSMYPGLPSRLEKELKQLWLTRVLGGNPERLSKFKVRIEDP
PRRRHMVFLGGAVLANIMADKESMWVTKAEWEEEGPRVLEKLGPR

Enzyme Prediction     

EC	4.2.2.24:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL26	37	924	0	0.9953596287703016

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214592	ACTIN	3.69e-164	1043	1421	5	370	Actin. ACTIN subfamily of ACTIN/mreB/sugarkinase/Hsp70 superfamily
240225	PTZ00004	6.45e-121	1039	1416	6	370	actin-2; Provisional
173506	PTZ00281	2.98e-112	1043	1421	10	373	actin; Provisional
227602	COG5277	2.36e-107	1043	1419	10	439	Actin-related protein [Cytoskeleton].
394979	Actin	1.62e-106	1039	1421	1	404	Actin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAE64737.1|PL26	0.0	15	919	8	914
UDD63997.1|PL26	0.0	15	919	8	914
QMW47023.1|PL26	0.0	15	919	8	914
QMW34948.1|PL26	0.0	15	919	8	914
QRD91285.1|PL26	0.0	15	919	8	914

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XQG_A	0.0	33	930	5	905	Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_C Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_D Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_E Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_F Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_G Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQG_H Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose [Penicillium chrysogenum],5XQJ_A Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_C Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_D Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_E Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_F Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_G Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum],5XQJ_H Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with unsaturated galacturonosyl rhamnose substituted with galactose [Penicillium chrysogenum]
5XQ3_A	0.0	33	930	5	905	Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum [Penicillium chrysogenum]
5XQ3_B	0.0	33	930	5	905	Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum [Penicillium chrysogenum]
5XQO_A	0.0	33	930	5	905	Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with tetrameric substrate [Penicillium chrysogenum],5XQO_B Crystal structure of a PL 26 exo-rhamnogalacturonan lyase from Penicillium chrysogenum complexed with tetrameric substrate [Penicillium chrysogenum]
6W17_B	6.32e-204	1043	1425	7	388	Structure of Dip1-activated Arp2/3 complex with nucleated actin filament [Schizosaccharomyces pombe 972h-],6W18_B Structure of S. pombe Arp2/3 complex in inactive state [Schizosaccharomyces pombe 972h-]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32381|ARP2_YEAST	5.10e-206	1040	1425	5	391	Actin-related protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARP2 PE=1 SV=1
sp|Q9UUJ1|ARP2_SCHPO	3.25e-203	1043	1425	7	388	Actin-related protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=arp2 PE=1 SV=1
sp|P61161|ARP2_MOUSE	3.89e-182	1043	1423	10	390	Actin-related protein 2 OS=Mus musculus OX=10090 GN=Actr2 PE=1 SV=1
sp|P61160|ARP2_HUMAN	3.89e-182	1043	1423	10	390	Actin-related protein 2 OS=Homo sapiens OX=9606 GN=ACTR2 PE=1 SV=1
sp|P53488|ARP2_CHICK	3.89e-182	1043	1423	10	390	Actin-related protein 2 OS=Gallus gallus OX=9031 GN=ACTR2 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000230	0.999758	CS pos: 21-22. Pr: 0.9789

TMHMM  Annotations     

There is no transmembrane helices in EPE02655.1.