CAZyme Information: EPE02551.1

Basic Information

• Species: Ophiostoma piceae
• Lineage: Ascomycota; Sordariomycetes; ; Ophiostomataceae; Ophiostoma; Ophiostoma piceae
• CAZyme ID: EPE02551.1
• CAZy Family: AA11
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:S3BSZ5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330	KE148177|CGC1	34865.45	9.4125

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_OpiceaeUAMH11346	8884	1262450	0	8884

• Gene Location: location=KE148177:146947-147939(-)

Full Sequence      

MVSSFLSQALLLAAVAFDCASAFPAHYRHVAPRATSVGVVGNIRIPTGYTTTLFSDGFAG
TVGSLPSTDRWTIDVGTQYTGGAAKWGTGETQTYAKSTSNLKITAAGTLLITPVKTTTNG
KTTWTSGRIENIKTWDFTAAVGKKLRIESRLKLGGANAASKQLGIWMAFWSLGSAYRGNY
QNWPAIGEIDIMESLNGAARAYETVHCGTSSGGPCLETTGISTSNTMYRSVWYTVAVVVD
RTASKTASDWKGESITWLMNEKVLFTVKATTVNNQAAWKALAQTAKFLLLNVAVGGSFPD
AVAGVTTPTSATLGGEGSSLEVDYVAVFTS

Enzyme Prediction     

No EC number prediction in EPE02551.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	55	328	3.7e-46	0.991304347826087

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185691	GH16_Strep_laminarinase_like	9.09e-102	48	329	1	259	Streptomyces laminarinase-like, member of glycosyl hydrolase family 16. Proteins similar to Streptomyces sioyaensis beta-1,3-glucanase (laminarinase) present in Actinomycetales as well as Peziomycotina. Laminarinases belong to glycosyl hydrolase family 16 and hydrolyze the glycosidic bond of the 1,3-beta-linked glucan, a major component of fungal and plant cell walls and the structural and storage polysaccharides (laminarin) of marine macro-algae. Members of the GH16 family have a conserved jelly roll fold with an active site channel.
185693	GH16_laminarinase_like	4.03e-33	54	328	1	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185690	GH16_fungal_Lam16A_glucanase	1.65e-06	164	227	95	147	fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Group of fungal 1,3(4)-beta-D-glucanases, similar to Phanerochaete chrysosporium laminarinase 16A. Lam16A belongs to the 'nonspecific' 1,3(4)-beta-glucanase subfamily, although beta-1,6 branching and beta-1,4 bonds specifically define where Lam16A hydrolyzes its substrates, like curdlan (beta-1,3-glucan), lichenin (beta-1,3-1,4-mixed linkage glucan), and laminarin (beta-1,6-branched-1,3-glucan).
185694	GH16_CCF	5.20e-05	165	327	129	328	Coelomic cytolytic factor, member of glycosyl hydrolase family 16. Subgroup of glucanases of unknown function that are related to beta-GRP (beta-1,3-glucan recognition protein), but contain active site residues. Beta-GRPs are one group of pattern recognition receptors (PRRs), also referred to as biosensor proteins, that complexes with pathogen-associated beta-1,3-glucans and then transduces signals necessary for activation of an appropriate innate immune response. Beta-GRPs are present in insects and lack all catalytic residues. This subgroup contains related proteins that still contain the active site and are widely distributed in eukaryotes. Their structures adopt a jelly roll fold with a deep active site channel harboring the catalytic residues, like those of other glycosyl hydrolase family 16 members.
185689	GH16_fungal_KRE6_glucanase	0.007	86	328	30	294	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLI64343.1|GH16_3	2.52e-91	46	328	35	308
UNI19827.1|GH16_3	2.26e-89	29	328	24	319
QBZ61307.1|GH16_3	2.11e-86	43	328	102	385
AAX07660.1|GH16_3	4.21e-86	43	328	102	385
QPG94915.1|GH16_3	5.03e-83	34	330	41	333

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DGT_A	2.04e-60	46	327	6	273	The 1.5 A crystal structure of endo-1,3-beta-glucanase from Streptomyces sioyaensis [Streptomyces sioyaensis]
7EO3_A	3.90e-58	51	330	11	280	Chain A, 1,3-beta-glucanase [Actinomycetia bacterium]
3ATG_A	1.46e-20	53	328	6	238	endo-1,3-beta-glucanase from Cellulosimicrobium cellulans [Cellulosimicrobium cellulans]
2HYK_A	9.00e-14	51	328	8	242	The crystal structure of an endo-beta-1,3-glucanase from alkaliphilic Nocardiopsis sp.strain F96 [Nocardiopsis sp. F96]
2VY0_A	2.79e-11	63	329	23	260	The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus],2VY0_B The X-ray structure of endo-beta-1,3-glucanase from Pyrococcus furiosus [Pyrococcus furiosus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q27082|CFGA_TACTR	1.87e-08	53	328	28	252	Clotting factor G alpha subunit OS=Tachypleus tridentatus OX=6853 PE=1 SV=1
sp|P45798|GUB_RHOMR	7.00e-07	65	298	53	259	Beta-glucanase OS=Rhodothermus marinus OX=29549 GN=bglA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000229	0.999753	CS pos: 22-23. Pr: 0.9784

TMHMM  Annotations     

There is no transmembrane helices in EPE02551.1.